Annotation of coherent/c/usr/bin/ckermit, revision 1.1

1.1     ! root        1: &�� To
        !             2: 3����F� �P�g�́VWU��F�j��F
        !             3: �����6,_hˌ�§���._���0_�l��6_�z��j�}j&�����>��~�����>�t��H��~&~2����>�t%��G�>�u h���v���>�t�Rej�Z���X����>�t��G���_^�VW���&j;�vh��虧���Ս�F����F�Ƈ�v��F��~��F����
        !             4: �u�n��~��=>u��_^�VWU��F
        !             5: HPh���v�L����~
        !             6: ~��_^�VWU��>�u
        !             7: �6��y���h��h�
����_^�VWU�����؄�to�xo�vo������_^�VWU���to؄�>to��s
�>to��to������F�����_^�VW��~�=t#�=\u�F�F��~��=t�E&���F����F���_^�VW��~
        !             8: t�vh�i�������H�F�P�v
        !             9: �v����F��~�|/h���h���th��蓓���~��F���v�h'��������_^�VW��~�=u�F<�~�H�F�P�v
        !            10: �v����F��|>�v��u���t�v�hI�Ν������ �v���y���}�v�hg���F��~��F��_^�VW�+��F����~������F�=&t�9
        !            11: �F���v
        !            12: �;�����~����5�����~���&F��F�=v�����.��5E�EEKK���F���~�u
        !            13: �F
        !            14: �~���~����~�=�=u�����~�5����~��=t(�v�4�7|�����Ǚ�F��V��t��~�5h��M�~�5�Ix���F��V��~��t��~��t��~�5h���~�uQ�~
        !            15: �=t"Wh耜���v
        !            16: �����v
        !            17: �5
�����&�*o}�*oh$oj�.o���&�>$o�$o��&�~�5��&���~��uš����F�~��F��*�~��N��h���]{�����Ǚ�F��V��~���u        h��h�r&�~�y  h��h'�c&�~�~�k�|     �~�&v�`�h��>{������F�PhD講���v�����6vo�`���~���+�����&�~�=uhH�y�����vhb�k����~�������F�~��F��*�~��N��h���z�����Ǚ�F��V��~���u h��hf��~�y  h��h}�h�������F��F��;V�|;F�sh��fz��h������F����x�   h��˚��h؄h��h�輚���p�F��V��~�x�z��~�5h��'�~��u�~��u
        !            18: �~�5h���~�x�Q��~�5h��s�������_^�VWU��~�=t�=*t�=?u�&��F��+��_^�VW�+��F����~������F�=&t���F���v
        !            19: ��
        !            20: �����~�����&F��F�=v������.����D������F���~�u
        !            21: �F
        !            22: �~���~����~�=�=u��F����҃~�u%�v
        !            23: h�蝙���v
        !            24: �
        !            25: ���v
        !            26: �R
        !            27: ����+��\�*o}�*oh$oj�.o���;�>$o�$o��.�~�=uh��N�����vh��@���h؄h��h��1������F����_^�VW����>���u�~�5�Π���zo�
�~���zo�������F�=&t��F��vo�~���&zo�F�=v�����.����i�����8�\�F��ʋF���zo��>zou�F
        !            28: �~���>zou�v
        !            29: h��p����v
        !            30: ��������*o}�*oh$oj�.o��뢋>$o�$o�땋~�=uh��,�����vh�����h؄h��h������d��v�h��������_^�VW�+����F�����F�=&u6�v�����&F��F�=v��&����.�����
        !            31: ����      �       �^�F��ˋF���&�>�u    �v�S���F�P�v
        !            32: h���v�C���F�=��u�&=��u�&�F��&�>�u'�~�=t;WhO�G����v����v�������F�P�v
        !            33: h���v�����F��~��u'�*o}�*oh$oj�.o���S��>$o�$o��E��~��uh��hS�ݖ���&kF���~���F�Phc辖���v��-���L��F�P�v
        !            34: h���v�i���F��~����h؄h��kF���~�5hg�y�������~�=uh{�e�����vh��W����[&�F��F�;F
        !            35: }J�6�h��kF���~�5�����u)j&kF���~�u����ukF���~�5�"&���F���&h؄h��h��땃��>��v�h����h��h-���h��h?����~��t�N�hp軕���������_^�VW�+����F��>��&u��M�F���&F��F�=w�����.���
        !            36: �
        !            37: �
        !            38: (M�F��g�~�~_h��h��R�������P�*o}�*oh$oj�.o��뜋>$o�$o�돃~�~h��h���h ����h؄h��h:�����f�+��_^�VWU�����+��|��ڑ�_^�VW��ڑ�F��F�;�}�~�=t�6|��|��F�������F��؋~�=t     �>|�ƅ��+����>�;ڑ~�F�;�}"�>|��|�ƅ�� �F���>|��|�ƅ����_^�VWU��>|��|�ƅ��h��h?�@����D��_^�VW��v
        !            39: �|���F��t�~&}������F��FH;F���v
        !            40: kF���~�5�\����tG�v��v
        !            41: kF���~�5軛���u�&�+��F��t4�v��v
        !            42: �~�Gk���~�5菛���t�F��~�kF���~�E�D�~�t����9�F��n��v��v
        !            43: �~Ok���~�5�J����u�FH�~��~Ok�뵸���_^�VW��F��F��F��xo�vo�>to��r�H+��F��F��>to���F��uD�>�t�F�&�o~�oho�o����>o�o�*�F��~��u����A�f���F�&�~�t��~�u�~�\u�F�&�y��~�u�F�
        !            44: hD�O����~�  u�F��~� uH�>to�to�F���~�t$�*o}�*oh$oP�.o���
�>$o�$o�F���>�t��vo���~�
        !            45: t�~�
uO�>to��~�t&�*o}�*oh$o�v��.o���
�>$o�$o�F���to�xo�6vo������&�M�~�uC�~�?u=�*o}�*oh$o�v��.o���
�>$o�$o�F���>to��6vo�c�����~�u�>to��6vo�F�����&�~�t�~�u_�>to؄v%hJ�\����to�>to�= u���>to��&�*o}�*oh$oj�.o����>$o�$o���vo;tos0����~�u-�to�to=؄vhN����>to������������I&�~�t��>to؄w(�*o}�*oh$oj�.o����>$o�$o������to�>to؄r�>to�= uhR脐���>to��ف>to؄r�>to�= thV�a����>to��to���to�f��~�u�>to�h؄h��hZ�1������~�t&�*o}�*oh$o�v��.o���
�>$o�$o�F����&�~�t�~�
        !            46: t
�>to�to�F���F����*o}�*oh$oj�.o����>$o�$o�h`诏�������to�xo�6vo�a����+�����_^�VW��F��~�=t�>to��s�6to�to�F����F��ۋ>to�to� �>to��to�xo�F��_^�VW����F����~���~�= u�F��~�= t#�=
        !            47: t�=t�=
t�v��F��F������Ջ~��F�����_^�VWU��~�=t�v������gmu+���F��&�_^�VW��F��~�=t)�v������gm&t�~��P�����~��F�F��ϋF��_^�VWU��F
        !            48: #Ft�&�+��_^�VW�&��<��=+��t�����j�~@���6��<�=-u+�>��=�E&��F��F��P�&���F��~�}�j&��������>�u%�>��gt�>��rt�>��ct�>t�t    h>�~���>��=t�>��st�>��rt�>��vt  hQ�W���>��vu#�>�t�>�uj&�%����t       hj�-���>��st�>��vt�>��rt�>��xu �>�t��&�>�t����&�>�t���>t�t�R�>��u�>�t�Rj����>�t
        !            49: �6��b������_^�VW��>��@�F��~u��F-a=v�a����.����d�Z��-�?    :�   �     cQ!R�            H��>��t     h��9�����x��>��t        h�� ��h�h�h�jF����������>��t  h��������v���>��t        h�������&�߃>��t h������~��}&t       h      ���+��v��F���@@�1��j�~2�>�����6��<�=-uh#    �>��5�0����u �F��v����j��>��.���>v�&}  h%      �O���~�&~     h=      �@���~�&u�>v�&u�v��      hN      �"���>v�uj������t        hy      ������s���>��t   h�      �����~��}&t  h�      �����>�����j��>j�t�6��<�=-u  h�      ����>�������r��t�&�~��&�u�����}�~��}&t     h�      �r���>�����j��>j�&|�6��<�=-u  h
        !            50: �H���>�����$�~��}&t     h 
        !            51: �*���>�����j��>j�&|�6��<�=-u hC
        !            52: ����>��5hˌ�̑��hj
        !            53: hˌ蚑���t�&�+���jh�hˌ�T���&�~��}&t       hs
        !            54: �&���>�����j��>j�&|�6��<�=-u h�
        !            55: �&���>��5�'���F�P�#��=��~       �F����N&h�
        !            56: �B&�~��}&t    h�
        !            57: �N&���>�����j��>j�&|�6��<�=-u h�
        !            58: �$&���>��5��~���F��~�
        !            59: ~;0}�.�,�~�^���,^��h�
        !            60: ����&����&����&�h�
        !            61: �B��~��}&t h�
        !            62: ����>�����j��>j�&|�6��<�=-u h����>��=���F-e=w7����.�������������������F�l��0�l��(h&���&����&�z��      h5����F��~����F�p�+��_^�VWU���vhah4o�Q���j&�����_^�VWU��>�u�vhƇhnh4o�'����_^�VWU������hd
�X����e����r�.��>r���>��tPW�f����>r��=/u
        !            63: hn
W�뎃�hp
�6r��ގ��hx
h.��"����ޑ�t���>��t-�>�}&hz
�6r�����h�
h.����ޑ�t����\�_^�VWU���_^�VWU��j��&���_^�VWU���]j��&����\�_^�VW��6���\��h�W���>�t�>8_u     h�
�&������>�t�y&�>��~C�6��拼ޑ�E@t3�>�������ޑ�׃���6:_�����>�}�h�.W��+��>&�>��~n�F�؄�F���>�����ޑ�v�h.�艄���t��r�.��v��F��>r��r����
        !            64: �t�N��F�=&}�h�
�&����Ӌ~��}�\u�n��h؄����>8_u����6:_�:���3�&���>3�u�
����h�
h�
�6(ht�����F�P��&��=w_����.�������j�e���3�&뭃>8_t      h�
�e����>��~h�
�u����>�����ޑ蠂�����6:_����3��f��>�u�V��*��_^�VWU���XQ�>�t�6,_hˌ�ڌ���._���>�u�[�>�u�@V�>�t�����j�^���>�t�����j��]���>�t�����j��]���>�t�`���j��]���9O�v�΋���_^�VW��v�q����F� �~
        !            65: ��v�F
        !            66: @P� ����F�@F
        !            67: �_^�VW��F�5��~��F��F��~���~
        !            68: �=t0�v�W�����F��~�=tPW�����F��~�=tPW�|�����5��g�_^�VW�.�F=/v�#  ����.��n������%�D�%W�%�%�%X�3k!�%�%�!�%�%�%�%�%�%��!?"�%w"�"#C#B$�$�$�%�$�%�%�%��!*�!�>�u�>8_u  h
萃��j�%���+��=   �F�7   ���F��}�*    �>�uh�`���h0h/h.jL��������ÍF�PhFh1����F��}����}�F��}�������F�P�6��hG�����}�����v�蚋���t       �v��z���r&�6Ta�{�R�h�hs�6h������F��~��uh�踂������l�~�}�F��`���F��}�S�F�=v�$����.����%�%�%�%�F�PhEh1�L���F��}��v��g����F�PhchF�&���F��}���r�.��v��6Xahe�6r��P���h.��:��F�Ph�hk�����F��}��~��=tu���F�=\u?�F�+��F��F��~��=0|)�=7$�~�}�v������F����-0�F��F��F����N��*o}�*oh$o�v��.o���
�>$o�$o�F���F��h������F�=�����j������F��}��>�uh����h�h�h�jF����>�uh����h�h�h�����F��~��u�n��~��u�e��F��>��=t��&�>�����>�����ޑjdh.���~���u        h�����h.����h.�芈���F��~�~�~���-�
        !            69: t��-�
u
�~�ƅ-��N�����.��>�����ޑh�h؄�~���u  h�'���h؄���h؄�(����F��~�~�~���ׄ
        !            70: t��ׄ
u
�~�ƅׄ�N��܀>؄u��.����؄�F���j(�F�P�����h8�g����6:_����F����>8_u���~��uh�hlhU����F���~�}
�F�P�$������>��=uhm����F�P�����6�h.��(�����.�hz��߃��6:_�����F����>8_u�A��~��uh�h�h��F���F���~��t��h���F����~��u��F���F�P�߃��~�t�v���r�>�u�g���&�^�h�h��6(ht�&���F�P�����9�F�=��~�PK�h�h��6h������F��~��uh�����~�}���v��X    �K��F�Phh�w���F��}�H�v��Wp�(���h�hDh�[����F��~��u���~��u����F��}���v�>�u����&���>�uhE�k�h�hd�6�h�� ���F��~��uh��I��v������������F�P�F�Ph�h��?����F��}�~��t�%�h��
��v����v�h.��I����>���~�t�Zh�h�h��y���F��}�J��.��>��=��s�2����F��}�(��x��h
        !            71: h�6�h*�]���F��~��uh���~�}���v������F�PhOh1�&���}���|S�΅�F��t��F�P�ЅP�Js���F��~�t�~��}�=u�F���~��E�F��F�F�~�=t�F�=/u��F�F���~��=ujhX�v��v����j�v�h[�v��v��ل��
        !            72: j&藃���Fj&j詅���F�j&j蜅���F�j�����F�;F�t�~��u��v�j�x����v�j�m����6���Q��h_h^jh�,���F��~�}��&�b�F��}��&�F��t=&th����,�i��6�I�6"hj��{���6�Yh~��{���6p�6�h���{���6t[h��{���6�h�6vbh��{�������F��}�N&�6Za�����F��}�:&�t�4&�>�~h����F�P�F�Ph�h��݃��F��}�~��t�&h����~�th      �y��v�h.�軂���w�F��}�����>���h6h.��y����ޑ�t�u�h.��r�����e�h؄h8��z���&��>�uh��k������j��S�a��>�uh��K������j�ރ>�uh��/������j�ƒ>�uh����`���j��v�h�^z������~�|�
        !            73: ��������F��_^�VW��P��?�F��6���O���F��_^�VWU��hL�Q���_^�VW��~}�F�&�F=+v�u&����.���&�&�'�&�&�'�&�'''�'''' '+'�'�'3'�'�'�'�'�'�''='B'�'�'�'�'�'�'�'�'�'�'�'�'�''8'�'&'�6��4&���*&�6����6���hu+��h�+��h�+��h�+��h,��h^,��h�,���6���h�,�h~�
&�h���h���h���h�,h�,�6�h��*���F�=��u��~��u�F���U��}�&�+��F��t��v����^��6��T��6��M�h-h�,�6�h*������F�=��te�~��t����}�&�+��F��uJ�v����h&-��h>-��h�-���h�-���h'.�������}�&�+��F��uh؄h�.�\x��+��_^�VW���F��|�v�sw��+��_^�VW��}��}�&�+��F��u9�F��~���~�=�=th$o�~���~�5��v���F���h$oj
        !            74: �v��+��_^�VWU��~�uh�������&�~}�F�&�FH=v�&����.���()]*))]*-)<)]*B)P)]*]*]*]*^)]*]*]*]*�)]*�)]*]*]*�)�)]*]*�)3*     *h��h�.�v���M&h/�v��he/��h~/h{/�<w���0&h��b�h�/�`v��h0��h*0�Rv��hs0��6,_h�0�
        !            75: w���>._t���6,_h�0��v��h1��v��hU1�v��h�1�v��h�1�v��h2��u��h`2�a�h�2��u��h�2��u��h13��u��h{3�@�h�3��u��h�3�1�h4�+�hM4�%�h�4�u��h�4�u��h
        !            76: 5�
�hG5�u��ho5�u��h�5�u��h�5�~u��h&6���hH6�ou��hq6�fu��h�6�]u��h�6�Tu��h(7��h؄hM7hJ7�     v��+��_^�VW��~�uh�������~}�F��FH=wX����.���*�*�*�*�*�*�*�*�*�*�*�*�*�*�*�*�*�*�*he7�M��h�7��h�7��h!8��ha8��h�8��h9��hI9������}�&�+��F��uh؄h�9h�9�Zu������_^�VW��F=v�����.��<+�+�+�+�+�~�}�F��N&�v�h.��|���F�.��`߉F��}�0&�F=wh����.��+�+�+*,a,�F����F��9h�9h�9��t��륍F�Ph:h�9�փ��F�됍F�Ph+:h:���F����F�7:h;:h8:���vhc:�t�������v�������j�}M���v�j��L���F��~�~�v�h����{�������F����tj�FM���v�j�L���F��~�~�v�h���{�������F����=j�M���v�j�uL�����>�~�v�h`��{{���F�P�SI����`����_^�VWU��+��_^�VW�h�:��r���6�hˌh�:�s���>�th�:�h�:�s���F��F�;d}*k^������c;�uk^������ch�:�cs����F��̓>l�tj�jh�:�Fs��h�:�=s���l��L-�CC.;��u7.�g
        !            77: emos|-b-r-m-w-h�:�
        !            78: s���!h�:��h�:��h&;��h;���6l�h;��r��h;��r���>�th$;�h+;��r��h2;��r���>z�&uh9;�r����>z�uhB;���6z�hG;�r��hJ;�r���>�t�6�hX;�xr���        h\;�mr���>�uj�jhb;�Wr��h;�Nr���><u�>*t   h�;�7r���68�6:h�;�&r���><t        h�;�r���6@�6>h�;�r���6Bh�;��q���l*�P�j*�Ph<��q���6�h<��q���~*�P�|*�Ph7<��q���64hN<�q���p*�P�n*�Phh<�q���>Ht
�6Fh<�q���6(h�<�~q���>*th�<�h�<�iq���6.h�<�\q���>.^~h�<�h�<�Gq���>Tt
�6Rh�<�3q���60�62h�<�"q��h�<�q���>�th=h=�h.=h(=��p��h6=��p���>�thM=hG=�hZ=hT=��p��h_=��p���>�th���hu=�p��hz=�p���>�th�=h�=�h�=h�=�p��h�=�p���>�th���h�=�zp��h�=�qp���>�th�=h�=�h�=h�=�Vp���>�uj�jh�=�@p��h�=�7p���>�th>�h>�"p��h/>h>�p��h7>�Co���_^�VW�h9>��o���6��6�hV>��o���6���6��hc>��o���6Є�6΄h�>��o���6���6��h�>�o���6��h�>�o���>�y��u
        !            79: �>�u���>��~g����RPjj
        !            80: �6���6���c��RP�rc���F��V�RPh�>�[o���>�~/���RPjjd�v��v��Pc��RP�<c���F��V�RPh&?�%o���6.�6(h#?�o���6DhV?�o��ht?��n���>Tt�6Rh�?��n���      h�?��n��h�?��n���>Ht�6Fh�?��n���h�?�h�?�n��+��_^�VWU���_^�VW��F�P�D���>�|T�>�&rK�>�|�>�&�>��~6jj
        !            81: ����RP�6���6���\b��RP�`b���F��>�~kF�d��>��F��_^�VWU���_^�VWU���_^�VW�
        !            82: �FH= v�����.��o2�3�3�3�3�24;4�6q4�4�2�6�6�2�2�6�2�2�25�6`5�6�6�6�5R6�6�2�4�5�5�5h�A�m��h�A�m��+��qhBhBjh�@�Ճ��F��}�V��׉F��}�I�F����ˍF�P�6,_hB�Kԃ��F��}�&�Y9�6,_�v��t���t�����._�F��6��F�P�v��7���}h+B��d��������~��~�F����v�hˌ�t���>�t�K������B�hCBhBBjh�?��ԃ��F��}��%׉F��}��F��B��h������{�F�Pj
        !            83: hoBhEB�'΃��F�j^P�v�h������ThrBhqBjh�?�ԃ��F��}�9��։F��}�,�F������F�Pj
        !            84: h�BhwB��̓��F�P�v�h�������h�Bh�B�6@h�?�1ԃ��F��}��=v�����.��i417b7�77h6Ch5C�64@h(@��Ӄ��F��}��3։F��}��F��z���h@Ch?C�6`@h6@��Ӄ��F��}�x�։F��}�k�~�W~+���&���F������hfChEC�6dh�c�Ӄ��F��}�5�ՉF��}�(�F�����hnChmC�6�@hz@�RӃ��F��}��ՉF��}���F��l��t      �H&�l��H�c��F�Ph�ChsC��у��F��}��~��="u"W�r��H�F��~�~��="u       �~�~���F��v��(����F�Pj
        !            85: h�Ch�C�8̃��F�j^P�v�h4��h�Ch�Cj&h�@�҃��F��}�P�u��&�]��~ uh�C�hDh.���q��h9Dh.��6&@h@�b҃��F��}��86�CC.;��u.�gH8�8$9i9�9�9�>�uheE�j��h�E�U��r�.�hˌh�E�6r��$j���F�Pj
        !            86: h�Eh.��g˃��F��}��'��}�&�+��F��t��v�����F��~�}�v�h�E�i������F����>8_t���Phˌh�E�i�������ӉF��}�9h؄hF�F�P����F��~�}��~�u�&�+�����h�Bh�Bjhb@�=у��F��}���uӉF��}���F����a�h�Bh�Bjhn@�у��F��}��F�Pj
        !            87: h�Bh�B�hʃ��F��}��~�t�~�t      h�B��h���ӉF��}�~�F����~�u       ������~�t���������h����hC뻍F�Pj
        !            88: h�Ch�C��Ƀ��F��}�0�~�t�~�th�C��҉F��}��~�u      ����~�t��&�����&�F�Pj
        !            89: hcDh:D�Ƀ��F�P�v��F�P����F��}��&�~ u   �F��p�&�F��n�&�F�Pj
        !            90: h�DhfD�XɃ��F��~ u4hP�v��F�P����F��}�v&�F��.�~�^~�^��F��,�)h�v��v��F�P��&���F��}�@&�F��(�*&�~�^�(&�>8_t�&h�D�Tg���&�F�Pj
        !            91: h�Dh�D��ȃ��F�P�v��F�P��&���F��}���~ u   �F��~���F��|���F�Pj
        !            92: hEh�D�|ȃ��F�j^P�v��F�P�;&���F��}��~ u �F��@��F��>��F�Pj
        !            93: hDEhE�5ȃ��F�P�v��F�P�7&���F��|_�~ u�F��l�N�F��j�F�F�Pj
        !            94: hcEhFE��ǃ��F�j^P�v��F�P����F��|�~ u�<&�F��8��F��:�F��_^�VWU��F�V:�CC.;��u5.�gn�,&X�`      ��%K�:�:�:�:�:�:�:�:�:�:�:�F�����_^�VW�hFhFjh�@��̓��F��|�ЉF��|
        !            95: �F��~�+��_^�VWU��~}�F�-�F
        !            96: ;F~�vh"F�e��������ωF�|
        !            97: �F
        !            98: �~�+��_^�VWU��~}�F�1�~
        !            99: ~�~
        !           100: t�v
        !           101: h>F�Fe�������ωF�|
        !           102: �F
        !           103: �~�+��_^�VW�8�~}�F��FH=v������.��s;�;+=X=�=�=N>N>N>N>N>N>�=N>N>�=N>
>)>�F�PhwFhaF�˃��F��}���F��FʉFȋ~��=u�G&�>��~c�>�����ޑj2�F�P�b���u  hxF�:܃��F�P�Cl���F��~����~�O��}�
        !           104: t�~�O��}�
t���~�O��E��N���h�F�<d���o~�oho�o����>o�o�*�F�=
        !           105: ty�~�
ts�f��F�=?uh�F��c���FʉF��F�뮃~�u%�*o}�*oh$oj�.o��됋>$o�$o�냃~�t�~�u�N��q��~�t��~��FȋF���]��~���*o}�*oh$oj
        !           106: �.o����>$o�$o�
        !           107: �FʉF���F��Fh�F�v��v�jC��ރ���+��G&�F�Ph�Fh�F�ʃ��F��}�-&jE�v��)&����*��&�F�Ph%Gh�F��Ƀ��F��}�&h'Gh&G�v�jD�pރ����<��}�&�+��F��t��h*Gh)Gh(GjH�r�h�hEGh+G�Ƀ��F��}��c뇍F�PhpGhFG�{Ƀ��F��}�jS�_��F�Ph�GhqG�\Ƀ��F��|sh�Gh�G�v�jU�p��F�Ph�Gh�G�7Ƀ��F��|NjT���F�Ph�Gh�G�Ƀ��F��|2h�Gh�G�v�jW�/��s��}�&�+��F��uh؄h�G�b������_^�VWU��~�=uh�G��a������hHh
H�v�v
        !           108: �P݃��_^�VW�R�v�i���F��>�u��>�t��FH=
v��&����.���>�>"?j?�?�?�?�?2@6@G@M@s@�@�@hH�8���v�58��j ��7���F�@��@�T�F��@=K~hH�c8����@hH��7���v��7���F�&�@��@=N�hH��v�vhH�F�P�%a���F�P��&h"H�
8���v��&�F
        !           109: =v��&����.���?�@�@)AUA�v�v�vh{H�F�P��`��
        !           110: �F�P�v7���F�P�dh��&�@�&�~
        !           111: Yu�&�~
        !           112: Dujj�v�v�T���t�p&�F
        !           113: .��@��@=N~h�H�z7����@�v
        !           114: ��6���D&j��h�H�[7��j?��6�C�h�H�:��F�&�@��@=N~h�H�57���F���@�v��6�h�H�7���v��6���F����F�&�@��@=N~h�H��6���F���@�v��6�z��v�v�vh�H�F�P��_��
        !           115: ��h�H���@��@=N~h#H�6����@h$H�6����@�y��@��@=N~h*H�6����@h+H�x6����@�M��@��@=N~h8H�[6����@h9H�L6����@�!hHH�<6��hIH��5�#�hSH�*6����@�_^�VW�P�>�tB�>�u;�~
        !           116: u$�~&uh�Hjjjj�����
        !           117: h�Hjjjj�h$Ijjjj�����
        !           118: �_^�VW��>�u�V&�>�t�L&��5�F��~��=&�N�j��5���F��}�(&%�"B�CC.;��t�&.�g&4B�B�B
Ch&Ijjjj�e���
        !           119: h9Ijjjj�T���
        !           120: �>�thFI�hMIjjjj
�7���
        !           121: hRI�6��6�jj�"���
        !           122: h_I�6ք�6Ԅjj�
���
        !           123: hlI�D�RPjj�����
        !           124: hyI�T�RPjj�����
        !           125: h�I�H�RPjj�����
        !           126: ��h�Ijjjj�����
        !           127: ��&���h�Ijjjj����
        !           128: ��&���h�Ijjjj����
        !           129: ���&�h�Ijjjj�+��_^�VW��K�F��>�I����狅�I�F�=��t�H=&w�����.��lC�C�C�CD$D3D=DhD�D�D�D�D�D ESE�E�E�E�E�E�E
        !           130: FF4F�F�F�F�F�F�FG3GKG�G�GH�F-HwH�E���t   ��I�s��>�t�+��I �`�j�T������I�I����I��IjI������I&�+���
        !           131: ��I��IC����
        !           132: ��I��IG��j&�^T���h6W���������&�fj&�������+���6������B�D�e
        !           133: �!1��I���6������>�It�6���I�P������I��I�=u����I���I�~��>�It������o����֍h�L�6�������֍�v����
        !           134: �t�������6���=���P����v�x��� ����֍h�L�6���f��j�q��j�i���֍�����I
        !           135: ������֍h�L�6���3��j�>��hQWh֍����t�C�hRW����hjW��h׍�+���t�5�h�W��h؍�6Xa�Y���t��h�W��h؍�6Ra�@���t���h�W��h�Wjjjj�����
        !           136: �v���'h�Wjjjj����
        !           137: �E2�s�j�t��h�W�j�h؍�6Va�����t��h�W�P��׍����>�t�>� u�&�+����>�t  h�W�6Za�h؍�6\a������>�t�G�h�W�&�h؍�6^a�z���t�-�h�W���hX���h�L�6���������<
        !           138: �thޅ���hn�������I�k�h6X�s������������.�����>�t�������>�thFX�����>�thHX���qh�L�6���i���
��
        !           139: �}hJX�����L�3��6����
���B�D�6���
        !           140: �����>�t�n�*.��I����>�t�[X��qX���P����֍h�L�6������j�����>֍��}��h�X������I�q���I�h��6�������t��h�X���a�|�H���h�X�����~�6��
        !           141: ���u�h�X�"��-�������I���6���Ѓ�������&�uj&�����f-��������>8_u���>�t��h�X�����h�X����_^�VW�h�b�f(���>�t�>�}h�Xjjjj     �&�F����6��F�Phˌ�5"���}h�X�փ~��~�F����>�t�������F��6l��6z�P��%���}h�X렠��=xu1��&�>�u*�>�u�6&�.���h�X�.��hˌ�^.�������=vu�>�u�>�u  hY�9.�����=su�>�u�>�u hTY�.��j&�O�����>�t���>�u h�Y��-���J#h�Yjjjj����
        !           142: �_^�VW���o�F��|o�F��F�|o��o&��o&�(+D-P����F���o�F��|o��o&�_^�VW��>Tu���o*�;Fu6�>�ou/�P�P=^}�U&�>P^u�>|��|��R��n��>|��|��V�>P&u-�P�v�����|�;^��̄�P�v�����&&�>P&~+�>|��|��R��n��>|��|��P�P ��n��P�F%�F��F%��F��>Ht�~�t�>|��|��F��n��F��F�~� |�~�u�>|��|��t*䈅n��F5@�F�t*�;F�u�>|��|��t*䈅n��>Tt�F�;Ru�>|��|��t*䈅n��>Ht�F�;Fu�>|��|��t*䈅n��>|��|��F��n��>|�ƅn��_^�VW��P�~�F�*�F��u���>Tt#;Ru�~�F�*����P�~�F�*�F��F��>Ht�F�;Fu�F���~�F�*�F��r*�;F�u.�~�F�*�F�%�F��~�@r�~�_v�~�?u       �F�5@�F��F�    F��>Pu�P&�>�u�~�
u�@��~�
        !           143: u�F�
        !           144: �>P�+��v��V
        !           145: ���}�����Ԅ&�ք���&����P��+��_^�VWU��>������F��>���+��_^�VWU���v�A*��+��_^�VWU��F#�Pj�.���}��&����+��_^�VW��>�o&t����o��Yh�o�����F��~�u  ��o�����|��>|����Y���n�
        !           146: �t�|�����Y�>�o�u�|���P�>�o�~�h�o����F��~�u��o���|��̄��o*�P�n�����o*��o�|�;FtQ;F~��F��~�>̄��n�*�~����Y
        !           147: �t�F���̄�|��>|�ƅn���>�o�t�H��>�Yt�>�+��|��_^�VW��>�Y~��Y�~�
        !           148: �}�>�ot�>|o�|o���F�
        !           149: �u�&��F�Pj�+��=��t�+��F��~�t+��B�Ԅ&�ք���&����� F��>�u�~�
        !           150: u��Y&�~�
�
        !           151: �F�*�~��&�_^�VWU��~�=Xu��&�~�=Zu��&�>�u�>�t�&�+��_^�VWU��+��У������΄�Є�������_^�VWU�����J����o�|o�D&+��H�F�>�t��&���x���v+������ޅ���>�t�8�_^�VW��F�P�h&�������v����P����_^�VW�h�����v���o�F�P�#&���>�o|��6���/���v��>v�}h�Yjjjj        ���
        !           152: +����>v�u�F�P�6��-���F�P�/���v��>v�&}�>�th�Y� ����h�Y���F��~�&}[�>�uhZ�h Z�փ>�o~�i�F��~�&}7뉃>�ou.�>�t�>��=tWhޅ�zW����9Z�h:Zhޅ�fW�����>�u�>�u
        !           153: �6���G��jS�
        !           154: ���&�_^�VW����C�F�PP�]W��P�6v�v�y���_^�VW�+��У������x��z��Ԅ�ք���֍h�L�6���u����>֍uh@Zh֍��V��h֍jjjj&�b��
        !           155: �>�t�>��=tWh֍�V���>��hޅh֍�r���F��~�t,hޅjjjj���
        !           156: ��&�����RP�����hGZjjjj  ����
        !           157: �F��_^�VW��>�u�>���=Du�&�+������P�%      ���F��>�u�>�t����ߋF��_^�VWU��+��������_^�VW�f�~uV�>��=tW�F�P�U����WZ� �>�t�F�Phޅ�+�
        !           158: hޅ�F�P�U��hޅ����u+����F��F���F�~o+��УԄ�ք�������x��z��v�����hv�%��hn��6|��6v�~tjX�jF�
        !           159: ���~u=�>�tIhޅ�v�RPjFj&���
        !           160: �F�Pjjjj���
        !           161: hXZ�6��6��jj�
h~o�v�RPjXj�~��
        !           162: ��&�����RP�8����o&�&�_^�VW��>�u�>�t����6�(+D-P�����F��t�hv�R��hn��v��6vjD�� ���F��_^�VWU��hv�+���~t�~�=tWj&�6vjZ�       ���hYZj�6vjZ�      ������_^�VWU��hv����hZZj�6vjB�^   ��+��������_^�VWU��>,^~�o�~�    �, �o��: �p��@ �q��l*�5@�r��p*� �s��t�#�J@=w!����.��sT{T�T{T�T�>l�t  �&�N�F�N�u��B0�v��>Tt�R�w���w�~�>`t�6^�+��>ft�>d�+��>Zt�X�+��� �x��>`t�6�+� �>V��o��.�,�.�>�\ ��p��,�.�>�\�� ��q�ƅr��>�t�V@@P�݃��o��_^�VW��N�>/�&|�~�E&�- ��P�F��(�F��>*t�F�;(}��~�
        !           163: }�P��F��(�><u*�>/�|�~�E�- ���F��~�}���F��8�>�j�>/�|%�~�E�- �>�>/�|�E�5@�j��j�>/�|�~�E�- ��
�n�n*�=r
        !           164: �n*�=v�n
�>/�|  �~�E���#�F��~� ~�~�?|�~�_~�~�}�F���#�t�>/�|        �~�E��+��L�>LYu�J&�*�>L ~�>L?|�>L_~�>L}�J��J�J=wP����.���V�V�V�V�H�9�>l�t2�H&�F&�$�F;Nt�>NYu�&�+��H�t�L�F�F�&�>/�|�~�E�-0�F��~�&|�~�~�F�&�F��B�>/�     |2�~�E ��R�>R ~�>R?|�>R_~�>R}�&�+��T��T+��b�h�\�>/�
        !           165: }��~�E
        !           166: �- �F�#Xt�>Zt�&�+��\�F�#dt�>ft�&�+��h�F�#^t�>^t�&�+��b�V
        !           167: �v6V������ ��&t�/�;V|�V�܃>htf�V@@;/�}[�>V��~���ȋ6VFFv������ k�_�- �F��>*t
        !           168: ;F�|�F���~�~���F��(�>(
        !           169: }�(P�>bt4�V@;/�}$�>VG~��- �F��~�&~�&��F��6��6&�>�t
        !           170: �6/��ك��_^�VW��>�t��>�ou��F����F����~�yv�>�o~�v��v��~i�>1��1��5hޅ��N���>�o}hޅ��&���F��~�tAhޅ��"���F��V��~�yhޅjjjj�S��
        !           171: 듋F��V������넸&��ޅ+��_^�VW�h�>�ot�&�V�>�ou�&���F��vP����uۍF�P�v�j#���F�P�v�����F��~�u�h[Zjjjj       ����
        !           172: +��_^�VW�f�>�thkZj&������>�t��>�u~�F��F��>�t P�v��"�
        !           173: �v�F�P��M���>�t3�F�P�!���؋ʃ��u���t�F�P�F�P��%���v��F�P�M���F�Pj�p���u+���F�P�v
        !           174: �wM���&�_^�VWU��+��У������Ԅ�քhlZj�2���_^�VWU��>�ot��o�j����>�u�>�thmZjjj&�        hnZjjjj���
        !           175: +������ޅ�_^�VW�j�X���F��}hoZjjj�1�~t"�>�u�>ޅt   hޅ��!��hpZjjj&�     hqZjjjj�?��
        !           176: �ޅ�F��_^�VWU���v���&hrZh~o�qL����o&��o&�$�|o�>�t����&����_^�VW��~������~��F@P�G"���t�"�F�P����hn�����&�+��_^�VW��~tr�~�=tj�F�~o�~�=t�v��F��F�����v��F��~
        !           177: �F
        !           178: ���
        !           179: �u�h~oj�
        !           180: ���~)+���o�v��&�����>�t����&���+��_^�_VW��>�t��*�F�����c�F�;�u�W�F��
��F��ܑ;xt�~�Tt�~�Qt�~�Nuz�F�;4~h<[hn��K�����n��E�`�~�Et��~�Nu�v@%?;ܑu�Y�B���>�t��*�F����n��$���F���F�;�u���F��F��k��C�F��_^�VW��F���z�j*�P����F��F��F�;>}�F��~��F��F�*䈅���~��F��|*�P�R������F��F��F��~��F��F
        !           181:  P�2������~��F��F��P�������FD�F�@@=^~mj ��&���~�����~��F��F��.�>�e P��&������~��F��F��.�>�e�� R��&������~�ƅ��F��F��P��� P�&����F�"P�&���~�����F�N�~�v��F��~�F��P�e&������ڋ~�ƅ��DH=v�����.���^�^�^_�~��F��F��P�&����F��P�&���F��~��F���%? P�&������~��F��F��P�F��P��&���F��~��F�%��� P��������~��F��F���%? P�������~��F��F�%? P�������~��F��n*�P�~������~�ƅ�Wh�����}����X�F��z�&�����&�����>�t"hG[j����>�th���v�j����v��F
        !           182: �RP�vj�ރ�
        !           183: �F��_^�VW��>l�u�F%��S�F%�F��l��9`�CC.;��u5.�gemosK`V`^`l`�~���|Z*���F�
���~���|Z*�5���F��_^�VW��v����F�%���F�%?�F��_^�VW��>l�t�����F��F��F��~�=t�v�*��#~���+�&F�V��F�݋F��V�%�+��_^�VW��>l�t�����F��F��F��~�=to�v�*��#~���+�3F�3V��F��V�%+ҋ���F��V�%�+ҹ���������拼�Z3�[��+҉F�V�F��V��������3F�3V�F��V��F뉋F��V�%��+��_^�VWU��hJ[j�6vjY����hv�+&���_^�VWU���v�v�uF��P�6vjY����hv�&���_^�VWU��hK[j�6vjN�o����_^�VWU��>zt�6zh��������hL[�v�RPj%j�}܃�
        !           184: �>�thU[j�&��hX[j�K���_^�VWU���v�i��hn��6|��6vjE������I�j&����ha[jjjj�܃�
        !           185: �_^�VWU���v
        !           186: �(��hn��6|��6v�v�����_^�VWU���6��&��hn��6|��6vjR�����_^�VWU��~��x�@�.�>�e��_^�VWU��hb[�L���j�����_^�VW��F������/��ܑ�������>�t����p*�F��F��~�|��F�*�P�68hh������F��~�}'�~��}j&蓷��hp[�v�RPjTj�ۃ�
        !           187: �T�N�F��&΄Є�&x�z��F��~����*�:~t�F�;F�}�F��F���F��F�;F�|�F��g��~�|��&�>�thq[j�h���v�j����F��F�~��F����*����F��ut�F��F�=~�&�~����*�F�ƅ��F��P�#������F�- ;�t�&�F��~�������*�ȋv���&�*�����k�_���+D�/��F���~�}�B&�F�+DHH�/��F��~��F����*����ܑ�~��F����*�F��F�&F��F������/�F��F�=~���F��F�;D}����~�����*�D��F�����~��E��~�ƅ��DH=v�����.��>e^eye�e�v�ܑ�RP�v�j�Rك�
        !           188: �F���F��P�������F�*���;��e�F�*������F�*�����ljF��F��P�����;F��9�F�*������F�*��������F�*������ƉF�F��P����;F�u�a��Q�_^�_@VWU��j&h�o�J5���_^�VW�<�>�uh�[�]:��������>�}h�[��>�|�>�~�6�h�[�0:�����6�h�hˌ����}�FƉF�hˌh#\P�4:���F�P��1��6�hˌh8\��9���6��6����PhX\��9��h{\��9��h�\��9���>�th��h�\�9���6������}h�\�:��6z��6��}���}      ��h]���HB�F�j&j�B���(B�F��~��u��hI]�$1��hd]�Q9��+��&�v[�~�u���~�&h�o��3���t�h�ej�LB���>~�u�j�Z��#��F�%;�uj�B��%�F�P��&�����v��o���P�2��=��~.�>�t��v��`���>�t��v�j�D���}����h|]�a0���~��r�j  �v��[A��j�7B����h�]��j&�0��j����F��};�>'uh�]�J8����v[�v[=}���h�]��/��j�v���@���&A��!F��v�����>�t�v�j����� �F��~��~��~�F��h��v���     ���F��~�����;F�}���>� ������h��v��d���>�t��v�h�j������_^�VW�hx[�s��h�^�H��j����%�F�P���h�^����F��_^�VW��F��o�~ }�F5@Ph�^��vh�^�v��T7���F��o�F��_^�VW�&�F;�uP�����F��F�*�P�U  ���W&�~��gm&t
        !           189: W�h1���F�F��i�
        !           190: CC.;��t�&&.�g 0?bchs�i�i�i�j�j�j�i�i�i�i�~�h�^�_
�������~�h�^��h�^�C
��hˌ�:
���>�|�6�h�^h���6��h���
���>�uj�jh�^h���^6���>l�tPh�^�����l��hj�CC.;��u,.�gemoszj�jj�jh�^�
h_�h_�h
_���h_����>�th_���h�����h(_�����%��F���F�v��j�>���_^�VWU��+��_^�VWU��+��_^�VW��>F_�~jh�p�v�J=���u�S&�V&�F�4_�~
        !           191: ��D_j�v�#>���F_�>F_}�v��,������ &j�vh�p�,=���~
        !           192: �=tnh�_�v�r<���u�D_�Vj�,���tDj�B.���F�jP�F�P��<���6F_�(.���F�j�F�P�v��<���u+���&�D_��D_&�>_�>D_~5�v�y���}"�vh�_h4o�4���6F_�=���F_���:��>_&�~
        !           193: �=t�D_�jjE�6F_�=���}h�_h4o�P4��hpjA�6F_��<��hpjA�6F_��<��hpjA�6F_��<��+��_^�VWU��>F_|e�>D_t&�J�th�_h4o��3���N�th�_h4o��3���KjjF�6F_�<���}h`h4o��3���>F_�~
        !           194: �6F_�G<���F_��+��_^�VWU��>F_+��_^�VW��>F_}����,j&�+��hpj@�6F_�*<���F��~�}        hN`�+���F��_^�VW��v��:���F��~�~�~�O~��;F
        !           195: u      �F�HF��N���+��_^�VW�`�F�S`j/�v�����F��t@��F�F�Phc`�F�P�^:��P��9��j�v��T;���}hi`h4o��2���&��F�Ph�`�v�h<p�#:��P�9��P�9��jh<p�;���uAh<ph�`�F�P��9��P�9���F�P�+��jh<p��:���uh<ph�`�:2������j�v���:���}h�`�k�+��_^�VW���:�F��H_�v�����F��~�}����G�~�&t?h$&h<p�:���F��~�|�j�F�P�v��;���v��j:��h�&h<p�V:���H_&+��_^�VWU��>H_th<p�I;���+��_^�VW��>F_}����^�F�2_�v�����F��~
        !           196: &u�p&�~
        !           197: u�&p���p��&p���~��~
        !           198: �F��p��phpj@�6F_��9���|��F&+��_^�VW��>F_}����U�v�S���F��~
        !           199: &u�"p&�~
        !           200: u�&"p���"p��&"p���~��~
        !           201: �F��p��phpj@�6F_�9���|�+��_^�VW��~}��F�&�F��o�CC.;��u}.�gn�,&X�`   ��%K!p(p/p6p=pDpKpRpYp`pgp�F��f�F��_�F��X�F��Q�F��J�F�      �C�F�
        !           202: �<�F��5�F��.�F��'�F�� �F��vh�`h4o�
        !           203: 0��hah4o��/���~�t�F������_^�VW��>F_}����)�L_���J_jjH�6F_�}8���}      h7a�f'��+��_^�VWU��j&hp�Y*���_^�VW�j&j�8��=&u�&�+��F�j��&���F��~�u�~�u�&�+��8_�vj&�g8���vj�\8���>8_tj&j�K8��j&j�A8����vj�48��j&j�*8���@_&�_^�VWU��jj�8��jj&�8��jj��7��jj��7���@_�_^�VW�&�>L_|�L_�F��L_���g�>J_~
        !           204: ��p�>�p�Ih&h�p�6F_�i7���J_�>J_~    �>J_ƅ�p�>J_u�>4_t/�'����'�>J_|�+��>�p���p*�F��J_�F�*�%������_^�VWU��F�L_�_^�VW�+��_^�VW��v�v
        !           205: �6F_��6���F��~�~     �~�~
        !           206: ��~�}�F����F��_^�VW��>F_}�����v
        !           207: �v�6F_�o7���F��~��_^�VW��>F_}����Mh�pj�6��j�6��j&�FP�6F_�/7���F�hp�%(���t�F���j��5��jj�x6���F��_^�VW��F��F��>F_}����p&�>2_t�����F�~��~th�pj�+6���v�5��hp�'���t�F����&�F��F����F��~-�F
        !           208: +F�;F�}        �F
        !           209: +F��F�F�FP�v������F��}��F�&j�����F�=��t��~�~��F�F��F�;F
        !           210: }��F��F�;F�}��~�~�F� �~�~�*�;Fu)�F��~�~�j��4���~t
        !           211: jj�X5���F��o�~�~�*�%=u=�F��F�=&~7j�4��jj�$5��hDah4o��+���f�hJah4o��+������ �F��F��[�j�]4��jj��4���F��_^�VW��F��F��>2_t�����F��>F_}�����~'j&�F�P�6F_�X4���F��t�~�|׊F�*�%��^h�pj�z4���v��3��hp��%���t�F����j&�F�P�6F_�       4���F�j�3��jj�84���~�}�w��F�*�#F��_^�VW��>F_}����_^�VWU���_^�VWU��j�/3����o��o�_^�VW�j�3��+�o�o�F�����~�}+���F��_^�VWU���_^�VWU��j�"���t-h*pjAj�>3��h6pjAj�13��h0pjAj�$3���B_&+��_^�VW�j��!���u+��F�>B_u���F�p�:_&�:p �&:p��h6pj@j��2���F��~��~jh$o��)���F��_^�VWU��j�w!���u+��/�>B_u�=��F�p�:_&�4p�&�&4p��h0pj@j�t2���_^�VWU��>B_u+��'j�$!���t�j&�!���:_h*pj@j�92���_^�VWU��j&�FPj&�3���_^�VWU���v�v
        !           212: j&��2���_^�VW��v��0���F�P�vj&��2���_^�VW��F��~���~�=�=t�~���~�5�����F����_^�VWU���v����jhLaj&�2���_^�VW�+��_^�VW��F��~!j&�F�Pj�1���F��f���~�~W�F���Th�pj�1���v�  1��hp�&#���t�F����j&�F�Pj�71���F��f��j��0��jj�b1��룸���_^�VWU��j  j��0���_^�VWU���v�C���uo�~u�v
        !           213: �����`�~&u"j����th�a譟���A�dao�&�8�~��h�a�v
        !           214: �2&����`a�~�烽`au  h�a�k���~�烽`au�+��_^�VWU���v����uw�~t�~&u�fa$o�&�b�~��h�a�v
        !           215: ��%����`a�~�烽`auh�a����(��/P�0P�v
        !           216: ��/���~uj�~����`a��&���~�烽`au�+��_^�VW��v�,��=&}+��\�~u�>pat���F��9�~�狅`a=$ot �~�狅`a=ot�~����`a�#���F��~��Dž`a�~��u�����&�_^�VW��v�&��=&}����X�~�狽`a�E~&�~�狽`a�M�~����`a�~�狝`a�W����~�狵`a�<��*�F��~��t�%��~
        !           217: �+��_^�VWU���v�@&��=&}�����~����`a�v
        !           218: ��$��+��_^�VWU���v�&��=&}����&�~����`a�v
        !           219: �$���~����`ah�a�$��+��_^�VWU���v����=&}�����v�v
        !           220: �~�狽`a�E
�P�//���_^�VWU���v���=&}�����~uj&�F
        !           221: P�~�狽`a�E
�P��.���d�~�狽`a�M})�~�狽`a�E�~����`a�v
        !           222: �~�狝`a�W
        !           223: ����~�狵`a�<��F
        !           224: �*�=��u�v�拼`a�E�t�v�+��_^�VWU��F=w0����.���{�{�{�{�{�{�{�{�{�{�~�烽`au+���&��vh�ah4o�$������_^�VW�$�F�P�v�.���F��~�}�������X�F�%��F��~�t�~��t�����j�v��,���F��}����ɋF��V�F܉Vރ~��|�~��v�F܋V��+����_^�VW�8�FʉF��F��v��Fȋ~�F���
        !           225: �t�F���~�u����R�F��F��~�~�~�O��}�/t�N���~�uhb�F�P�+���   ��~��E�j�F�P�,���F��~�|�+��_^�VWU���v�-���_^�VW��~�=t1�F
        !           226: �F
        !           227: �F�������gm&t��P�����~���~���F�Nj~
        !           228: ��_^�VW�j�F��F��F��F�F��~��=tt�=/u
�F��F��F��]�v�������gmt�v��F��~���P�_���7�~��=~u�~��F��X�&�~��=#t�=.u�F��F�=&݋v��F��~�����F�넋~���F
        !           229: �F��~�.u       �~��F��X�F�P�v���)���_^�VW��~�=uhb�����F�F�P��*���u�&�+��_^�VWU��h b�����_^�VWU��%b�_^�VW��F�P��*���t���*�ra�t���F�9b�v��v*��j�n*��jhAb�*���}�j&�v���)��j�v���)���v��=*���[*P�����F�~�t�~�}�=u�F���~�E�F��F��F��~��=t�F��=/u��F��F���j�vhKb�v��v��)��
        !           230: j�=(���v���)��hNb�v��l���da�pa�&�        �>ra�u�+��_^�VW��>rat)j     �6ra�)��j�*���F�;rat�~��u��ra�6da����+��pa�da�&�_^�VWU��h�&h�q�v�����q�>�q~��u�q��q�_^�VWU�졪q��q�~�>�u��u�5�v��'����~���q@�_^�VW��F��F��F��F�&�F��F��u�~�=t�v��F��F����F���F�HH;F�}�F��u�F��F�HH�F��F�&�~�|�kF�
        !           231: �F��~��F��*�~��N��h�u�����F��F��N��~4�>�u��u��F��F�&F��~��=~uڋF�@P�����F�;F�~ljF��‹F�H;F�~�F�@PhPb�v�����~
        !           232: ��u��N��N��F��e��_^�VW�+��F��F��~�=/u�F�~�=u�j�����F��~�u     hTb�ɖ���~��E�~�u�F��F��  �F��~��E�F��F��F��~�} �~�=/t�=t�v�v��F����F��ڋ~�~���~�}�n��~�=/u�c��=u�[��F��F��_^�VW�h�v�5����F��~�=/u    �F�/�F��hpb�F�P��%���F��F���}��}
        !           233: v�F
        !           234: ��}�F��}�v��F�P�v��$���~�t�v������~��E�F����}�_^�VW�4�F�F�~u�N�~��v
        !           235: �&�&�v�}&���uT�v�v�g%���v�%��&F�~��F�P�v
        !           236: �l'���t���~�F�/�~�W�v
        !           237: �~�u������~��F�P�v
        !           238: �0'��=��u��F�@u�j�v
        !           239: �?&���F��|}j�v��v��6&���tbj�F�@@Ph�q�E%����q�~�=t�h�q�v�����t�h�q�v�$��h�q��$��F�F̋~��/@P�v
        !           240: �~�u�������v��%���_^�VW�jhsb�v�$���u�F��}}��}���<�v�l$��@�F��}=�}w��v�6�}�$���>�}��}��}��F�&�}��}�_^�VW�&�~�F���F�
        !           241: �t�~�*t�~�?u�&�+��_^�VW�+��F��F��v
        !           242: �~��:u�~
        !           243: �=u�&�R�F�F
        !           244: �ދ~
        !           245: �=t�~�=?t�~�=*u�F�F�F��F
        !           246: �F�뵃~�t�~��=t�F��F��F
        !           247: �F��F�+��_^�VWU��j&hF~����_^�VWU��jhF~�p���_^�VWU��~�=t��P�����v
        !           248: �����F���_^�VW�&�~�F���F�
        !           249: �t�F�*��j���%;�t����_^�VW��v
        !           250: ��"���F��v��"��+F��F��~�|/�v
        !           251: �~�~��:u�v�V�F�FP��"���u�&��N���+��_^�VWU��j�q#���6N~j��#���6P~j��#���_^�VW�I�F��>�uh�e�������L�>�uh�e��>�}hf���6�h�hˌ�����}�FʼnF�hˌh:fP����F�P�믋>�O�狅�c�F����F��v��!���F��~��&F��F�F��~��=t3�~��E�F��~��=t�v��~���:u�~��E&F���F����F����v�6�hˌhOf�����v�hwf����h�f����-��}h�f���6l�j�6�����}hg���hF~�Q���F��u��j�"��hF~�6���F��t�~�����dh1g�[���0h��j�~"��j&j�t"��=&thȄj�d"��j
        !           252: ��!���#�F�H=v�����.��a�i�n�s�χhVg�dh�g�_h�g�����F��}�~��=tA�v�������gm�t-�*o}�*oh$o�~���P�.o����6$o�$o�~�����F��h�g�h�g����������h��j�!���N~j&j�!���P~=&thȄj�!��j
        !           253: �� ���F�=t=&t���d�d=|��6�b� ��P�6�b�_���F��~�uj�m��%�o��CC.;��u4.�g
        !           254: 
0AKOTH�H������������F���빃~��u�F�&��F���F�&�F�&��F���뒃~��u��F���~�&t�~�u���j&����B��~�u&jhF~�U���~��u�u������~��u
        !           255: �����j����h�&�z��j
        !           256: �����~��u�u�����~��}t�u�����h,&�H��j����v�����;��v�~��uh�}�+���~��uh�}�Y����~�uj����   �j
�5���F�h�gh�}�U���~�t��F��͉�CC.;��u.�g     &f������F��~�d}%j����%�~����}���}
t���}
        !           257: t�F��Ջ~�ƅ�}�~�t��F�H=
w�����.��+�G���k�k���8�g�����6�����h�gh�}������u�V��F�&h�h�g�t��B�h�gh�}������t�F�&h�gh�}�����t�F�h�gh�}�����t�F�h�gh�}�����t�F�h�gh�}�o����t�F�h      hh�}�Z����t�F�hhh�}�E����u���F���hhh�}�*����t�F�&h%h��h0hh�}�����t�F�&h8h�hChh�}������t�F�&hFhh�}������t�F�hKh�hShh�}������t�F�&h[h�j�hghh�}�����t�F�hohh�}�����t�F�&hxhh�}�����t�F�hhh�}�m����t�F�h�hh�}�X����t�F�h�hh�}�C����u���F�&��h�hh�}�(����t�F�&h�hh�}�����t�F�h�h��h�hh�}������t�F�&h�hh�}������t�F�h�h��j�Z��%�F��~�Au�F�&�~�Bt�(��q�j�5��%�F��~�t�~�
t�&�+��F�����~�1u�F�&�~�3u�F��~�5t����*�j�5���~�&tjhF~�[��h�&���j����~�t�6l�j�6������|��>�u h�h�N��+��_^�VWU��j&hX��
        !           258: ���_^�VW��V��F��~�|�0�>R��=u�$�=-u��6R�������gmt�       �>R��=~t��&�R��>R����F������
CC.;��t�B&.�g"'bcdnqrstwx~K�=��u�~��!���Y����g�/��~��F�ƅR~
        !           259: �&�~��F�ƅR~
�&�~��F�ƅR~    �s&�~��F�ƅR~�e&�~��F�ƅR~?�W&�~��F�ƅR~~�I&�~��F�ƅR~'�;&�~��F�ƅR~"�-&�~��F�ƅR~ �&�~��F�ƅR~�&�V�&�&�~�ƅR~�V�&�R��&�&&��h�6R��D&�����gmu���R��>R���%��h�6R��D&�����gmu��R��6R�������k�h
        !           260: ǣ�h��F������gmu��F��%�F��6R��D&�����gmtG�R��6R��������F����LjF��D&�����gmt�R��6R��������F����LjF��~��F��F����R~��v��F��>R�����R~�R�����~�ƅR~+��_^�VW�
���R~�F�P�����������~-&F�dž������uj�����T�&�&Ɔ��dž������}������E�������h.�j���hX��!���t��6�h�����>T�t�dž������H;���~���������G��E���D������ۋ���O�j�]��%�E��>�t����O��E��Pj�������P���=�&s����O��E��P�X��P����P���������F�PhR~����u�&�+��T��K��T�j�'��j&j����_^�VW��F��<��F�hR~�+���F�h.�j���hX��
        !           261: ���t��j����hihR~����u1j�΃�P�}���>�u��>�u�hij�����hihR~�Z���u���h!i�݃~�~F�F�R~�~��=t��P�\΃��~���F����v�hR~������>�t�>�thR~j����>V�u3j
�΃�P������>�t�>�tj
�&΃�Pj����a��N���j����j&j�|���~�u�F��h,&�\������_^�VW��F�R��>�uh)i�������&�>�}hKi���6�h�hˌ�u؃��}hˌhnihR~�
��hR~����>�u�6�hˌh�i��
���R~�R��F��~��=t��P�5&��PhR~�����F��߃>�uhR~h�i�
���6z��6��b܃��}h�i�O�j&j����F��&�>R��=u��>R��=t�6R�������gmt�R����T��L��>T�u&�>R��R��=-un�����ud�>R��R��=-uW�Ћ>R��=t�6R��R�������gmt�>R��=t�6R�������gmt�R����u�>R��=u�T��.��u�J��v�j����h�i�x��v�j����>�u  h�i�x��+��_^�VWU��~ }�F5@Phj��vhjh`��y���`��_^�VW��>�t4�މF��~�~+�~�~�F�hT��v��ރ��F�hT�j������,��_^ø��#���&�[���[����������  �&�+���&����VWU��S�؋�S+��y
        !           262: �^�W���V�F�y���؃���r&FRP�V
        !           263: �F�y���؃�FRP�V���
        !           264: ��s���؃�[��]_^ËË܋_��Ë܍_VWU��P�V
        !           265: �F+�+�� ��������;wrw;?r+?w@��[��]_^��Ë܋_��Ë܍_VWU��P�F�'����F�g��F
        !           266: �'��֋�[��]_^��Ë܋_��Ë܍_VWU��P�v
        !           267: �~+�+�� ��������;Wrw;r+W��[��]_^�VWU����v+��F�����F���F��F���؉^���gmu�~�-u�F�&��~�+u       ��F���F��^���gmt��.�.F��-0���݃~�t������Nj�]_^�
        !           268: VWU��P� �F��~�t3�^��F�����t$�~��F��:u�=tG��=u׀|�=uы��+���]_^�VWU���:&�B���t�4�v�m���t���+�]_^�VWU���&����t�F;Du���+�]_^�VWU����>ju�*jP�jP�����j�u+����d��j�G~�OS�W����j���F��^��*�F�=��t!�~�
        !           269: t�~�:u�F���ۂs���F�F��밃~��t���d��6܂��F�?u��6ނ��F�?u�����F�?u�W�?����������F�?u�W�+����₉6肋�F�?u��6ꂋ�F�?u��6삋�F�?u��܂��]_^�VWU��>jt
        !           270: �6j�G��]_^�VWU��>jt�6j�}���j]_^�VWU����F�P�AP�v����|�&�+���]_^�VWU��v�;�j}��㋿Bj��,j�t�4oPV�����4oP�=jP�����4oPW�����4oP�@jP����]_^�VWU��P�v�   �P�P�����F�V�Z�����t2�t%;�vW�E��+�P�7���V�+���;�t�;�s�+�+�P����v��P���W�����]_^�VWU��~u���9�>�t����]_^�VWU������F��}�����~�u"+�P�v�AmP�>mP�6mP�]��
        !           271: �P����&P�P�)�����&P�P����F��F�P�����;F�t�}��}�v�W�P�����v��P�����F���]_^�VWU���v����|�Dm�+�]_^�VWU���"�F�P�v�7���|�dmP�ZmP�������u������~�F�F��F��D~�LV�T������*�=
        !           272: ta�D~�LV�T������*�=
        !           273: tC�D~�LV�T������*�=
        !           274: t%V�P�ImP�����t�
        !           275: P�DmP�
���u�F����8�
        !           276: P�DmP�&
������F�P�DmP�X���|
;~�u�F�;F�t�F��B�V����F���]_^�VWU��~��gm&t�F
 ��F]_^�VWU��~��gmt�F%����F]_^�Y�܋�/�g�O+���܋G�_�;Nt�n�u�����]_^�g�gVWU����>pnt+���F%��F�;Fs�F�F��jn�hn�v���
����=��u�pn&�~�&v}�n�&�~�s��F��҃>nnu�ln�ƉF��hn�jn�/;6nnu���F��D�F��ln��nn-���E�F��u�ln�F�-
&���F��nn-����F��E�&��]_^�VWU����~u+����F%���F�;Fr�+��6hn�ln�F��F��N��t$��N���&uC+��~�t
        !           277: �F�%�����D����;6hnt�P�rnP�P�
���
�v������u���t���F�%��&��F��ln�F�;F�s��뜋F�)F��F�=s�%���F����F��hn��F����F��hn�F��hn��ln�D��]_^�VWU��~tE�FHH���<��s�P��nP�P�������&�ρ������;hnt
        !           278: �hn�&u�6hn]_^�VWU��v�D&u����/V�w�����D
�P�x���|t�Du  �t�r����D��]_^�VWU��~|6�~}0��n��os'�<t�<�E&u�v�4�v
        !           279: +�P�1
��������+�]_^�VWU��v�D��D�uI�+D���~W�t�D
�P������;�t�>u�|�D;u�D����D+���L����]_^�VWU����v
        !           280: �F�F�N~<�^�G~�OS�W����^���F��^��*��=��t�^��F��Lj�=
        !           281: u��^�����u�F�;Fu+���F��]_^�VWU���n��os(�<t�<�E&u���P�4�v
        !           282: �v���������+�]_^�VWU��v
        !           283: �L}�DV�v�T
        !           284: ����<��F�*�]_^�VWU��P�v�~
        !           285: �<t<�M}�EW��F��P�U
        !           286: ������F���F���^��*�=��u��E�tĸ����&��]_^�VWU��v�<tF�*o}�*o�$oP��F��P�.o����$o�$o��F���*�=��uƠ0o����ǀt�����2�*o}�*o�$oP�
        !           287: P�.o����>$o�$o�
        !           288: �*�=��t̸&]_^�VWU��v+�PPPV�u
�����u�d��]_^�VWU��v�~
        !           289: �|u�|�L]_^�VWU��FP�$oP�j��]_^�VWU��F
        !           290: P�v�T��]_^�VWU����F�P��P�v����F
        !           291: P�F�P�)���N�}�F��F�P+�P�V����      �~��F����]_^�VWU���^�F
        !           292: �F��^���F�F��^��F����=%t/�u���^�O}
�GSW�W
        !           293: ���ԋ^���F��^��Lj���F� �F����F����^��F������-u�F�&�^��F������F���0u�F�0�^��F������*u'�^��F���F��}
        !           294: �F�&�؉F�^��F�����0�F���0|&��9!�F�.�.2��ȋ��-0�F�^��F�����Ճ�.uY�^��F������*u�^��F���F�^��F�����0�F���0|&��9!�F�.�.2��ȋ��-0�F�^��F�����Ճ�lu&�^��F������dt��ot
        !           295: ��ut��xu��%�����F��F����F�&�ǻ���CC.;��t��.�gDOUXcdefgorsux�u�Y�z�ңҢ�����������^��F���F�~�}�؉F��F�-�
        !           296: P�v�V� �������
        !           297: P�^��F��7������^���W�F�V�F��~�y���؃��F�V��F�-�
        !           298: P�v��v�V�?��뤸
        !           299: P�^��w�7V�*�����F�������V�v��v�W������F��j�F��^���F��u�F��F��F��F�����F�?t�~�|��+F�;F�~�N�-�F���F�F��^��F���^����^��7�v������F��F�F�+ƉF��}�F��~�uz�~�tG�~�0uA�^��?-u9�^�O}�GS�^��F���P�^�W
        !           300: ����^���F��^��F����^���F��N��t#�^�O} �GS�v��ŋ^���F��^��F���;v�v;�^�O}�GS�^��F���P�^�W
        !           301: ���ڋ^���F��^��F����^�����~�u�*��F��N��u���^�O}�GS�v��W
        !           302: ���܋^���F��^��F���ȋ�]_^�VWU����v
        !           303: �F��F��N��^����+��v���t �N��F��F��+��v�ڊ���^������N��^������^��?t�F�F�F��F����^���F��]_^�VWU����v�~�n��N�^���ǙRP�v�v
        !           304: �Z���F�V��t4�N�F�F�ǙRP�v�v
        !           305: ����؊���^��F�V�F
        !           306: �V��N�F�F�F
        !           307: �؊���^��^�?t
��F�F��F���Ƌ�]_^�
        !           308: VWU�츤nP�4oP�E����&P�6&��]_^�VWU��v�|u:�Du(�D
�P������t��$ou�P�����D�u�Dʪ�D
        !           309: ���A�Du�t��$ou�DD��D
        !           310: ��D��DD��D
        !           311: h��D
�P���D��D�D]_^�VWU����&P+�PP�v�U���؋ʉ^��N����u  ���u+���F�+�.�6���‹�]_^�VWU��vV�$���V�T��]_^�VWU��v�~
        !           312: W����WV�U
        !           313: ��]_^�VWU��o���nr�<t�4��������]_^�VWU������v�X��]_^�VWU��v
        !           314: �~���+���O��
        !           315: �u��F]_^�VWU��v�f
        !           316: ��:�t
        !           317: �u����N��]_^�VWU��v
        !           318: �~����u
        !           319: �u��wA�&I��]_^�VWU��v
        !           320: �~���
        !           321: �u��F]_^�VWU��v
        !           322: �~����u
        !           323: �u�A��]_^�VWU��~��׹��+��O��+�]_^�VWU���N�t�v
        !           324: �~���u
        !           325: ����wB�&J��]_^�VWU��~�N�t�v
        !           326: ���
        !           327: ����F]_^�VWU���v
        !           328: �F
@P�p��]_^�VWU���6 �F
        !           329: P�v�Y��]_^�VWU���
        !           330: �F�P�O���~t�F��V��~��U�F��V���]_^�͡�͛�͌�͏�͐�͆�͈�ͩ�͋�͂�͜�ͣ�ͯ�͔�͘�Ͷ�ͥ�͓�ͅ�͝�ͪ�̓�VWU��+�P������~t$��F��;�v�����V����>u��]_^Ë܋O��w�&v
�ީPQSͰ[YY�Ͱ=��t�O�_ۃ�Bo�t��Bo��Bo��6ro�6po�6no�6loPQRSU��^S���Bo[�^�N�^�N][ZYX�lo�no�po�ro����͒�͊�͇�̈́�VWU��̀��]_^�VWU��vV�����t����i�>.o�u
        !           331: �$oP�����D+DP�t�D
�P������؉D=&u�>t�L��D믃|u�L@룋D�D)D�<��*�]_^�VWU��P�v�>.o�u
        !           332: �$oP�.���D��&P�F�P�D
�P�^���=��t�t�F�*���>t
        !           333: �L���L@�����]_^�VWU����v�~�F�&�F��F��^
        !           334: �F
        !           335: ��F��F�r�~�rt���F��F�w�^
        !           336: ���F�
        !           337: �t�~�bt�~�+t�F��:F�t���F��}�~�u�v��v�������}:�~�u�~�t.��&P�v�Z������|�~�&tW�C����v��v�k������|p�~�t�P+�PPW�L����u�P�-������u     W�&����>�D&+��D��D�D�D&��D
        !           338: @��LjD
����~�wu�F����~�au�F���+���]_^�VWU��v�~
        !           339: W��&���t�����E+EH�E����*�*�]_^�VWU��P�v�~
        !           340: �ƈF��E��E�u4W�~&���u)�&P�F�P�E
�P�U���=&u��*���>t�M������]_^�VWU��v�~
        !           341: �E�E;uW������u���ƈ*�=
        !           342: uW������t������*�]_^�VWU��v�F��D�D0��F
        !           343: �؉D�|&�}�D��D
        !           344: ����D
        !           345: ����]_^�VWU��v
        !           346: �D���]_^�VWU��v
        !           347: �D��<��F�*�]_^�VWU��v�~&u�Dt�n
        !           348: &�^V�l��=��u����B�v�v�v
        !           349: �D
�P�X����؋ʉ^
        !           350: �N���u���tӃ|t�F
        !           351: %�&D��D�d�+�]_^�͑�VWU��v�D���]_^�VWU��v�DtV�T���D;w      V����8�&P�<+|�ǙRP�D
�P������؋ʃ��u
        !           352: ���u������D�D+�]_^�{NULL}0123456789ABCDEF���&ZZZ
        !           353: &
        !           354: &&&��Y~
        !           355: &

##��&&����&���C-Kermit, 4E(072) 24 Jan 89C-Kermit Server REMOTE Commands:
        !           356: 
        !           357: GET files  REMOTE CWD [dir]    REMOTE DIRECTORY [files]
        !           358: SEND files REMOTE SPACE [dir]  REMOTE HOST command
        !           359: FINISH     REMOTE DELETE files REMOTE WHO [user]
        !           360: BYE        REMOTE HELP         REMOTE TYPE files
        !           361: 
        !           362: 
        !           363: C-Kermit server starting.  Return to your local machine by typing
        !           364: its escape sequence for closing the connection, and issue further
        !           365: commands from there.  To shut down the C-Kermit server, issue the
        !           366: FINISH or BYE command and then reconnect.
        !           367: 
        !           368: �N�Unix cmd package V2(023), 13 Jan 89Command? 
%scmnum: illegal radix - %d
        !           369: 
        !           370: ?not a number - %s
        !           371: Output file
        !           372: ?Wildcards not allowed - %s
        !           373: 
        !           374: ?Write permission denied - %s
        !           375: 
        !           376: ?No files match - %s
        !           377: 
        !           378: ?Too many files match - %s
        !           379: 
        !           380: ?Read permission denied - %s
        !           381: 
        !           382: ?File not readable - %s
        !           383: 
        !           384: ?File not found - %s
        !           385: %s 
        !           386: ?No files match - %s
        !           387: 
        !           388: ?Too many files match - %s
        !           389: %s  Input file specification %s
        !           390: ?No files match - %s
        !           391: 
        !           392: ?Too many file match - %s
        !           393: , one of the following:
        !           394: 
        !           395: %s%s%s  Please complete this field %s
        !           396: %s%s%s  Text string %s
        !           397: %s%s
        !           398: ?Unexpected return code from gtword() - %d
        !           399: 
        !           400: ?Ambiguous - %s
        !           401: 
        !           402: ?Invalid - %s
        !           403: %s 
        !           404: ?Invalid - %s
        !           405: %s  %s
        !           406: %s%s
        !           407: ?Invalid
        !           408:  One of the following:
        !           409:  %s, one of the following:
        !           410: %s%s
        !           411: %d - Unexpected return code from gtword
        !           412: ?Not confirmed - %s
        !           413: 
        !           414: ?Not confirmed - %s
        !           415: 
        !           416:  Type a carriage return to confirm the command
        !           417: %s%s %s
        !           418: clear    
        !           419: %s%s
        !           420: ?Buffer full
        !           421: y{*&}�&�����(��
        !           422: ���
�+����&���&�)���� !"$&&'-4&BSX    e
        !           423: oz�&�&�&��� ����&�!�&�&&�&�



 
%
  )
3
&;
C
P
[
&User Interface 4E(060), 13 Jan 89-l and -b required-a without -s, -r, or -gunredirected -k can only be used in local modeconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsinvalid argument bundling after -s-missing filename for -s-s: too many -'sinvalid mixture of filenames and '-' in -ssending from terminal not allowedconflicting actionsinvalid argument bundling after -gmissing filename for -ginvalid argument bundling after -amissing name in -ainvalid argument bundling after -lcommunication line device name missing/dev/ttyinvalid argument bundlingmissing baudunsupported baud rateinvalid argument bundlingmissing lengthUnsupported packet lengthdebug.loginvalid argument bundlingmissing parityinvalid parityinvalid argument, type 'kermit -h' for help
        !           424: Fatal: %s
        !           425: 
        !           426: %s - %s
        !           427: !%byeccdcloseconnectcwddialdirectoryechoexitfinishgethanguphelplogquitrreceiveremotesscriptsendserversetshowspacestatisticstakebaudblock-checkdelayduplexend-of-packetescape-characterfileflow-controlhandshakeincompletelinemodem-dialerpacket-lengthpad-characterpaddingparitypromptreceiveretrysendspeedstart-of-packetterminaltimeoutcdcwddeletedirectoryhelphostspacetypewhodebuggingpacketssessiontransactionsparametersversionsC-Kermit>/.kermrcr.kermrcr
        !           428: Command too long for internal bufferCommandKermit command error in background executionKermit command error: take file terminated.
        !           429: You have to 'set line' first
        !           430: Text of comment lineName of local directory, or carriage returnWhich log to close?You must tell which log
        !           431: ?Debugging log wasn't open
        !           432: ?Packet log wasn't open
        !           433: ?Session log wasn't open
        !           434: ?Transaction log wasn't open
        !           435: 
        !           436: ?Unexpected log designator - %ld
        !           437: Number to be dialedDirectory/file specification.%s %sMaterial to be echoed
        !           438: You have to 'set line' first
        !           439: 
        !           440: You have to 'set line' first
        !           441: Name of remote file(s), or carriage returntake file ends prematurely in 'get'take file ends prematurely in 'get' Remote file specification: Name of remote file(s)(cancelled)
        !           442:  Local name to store it under: Local file name(cancelled)
        !           443: C-Kermit commandhelpWhat to log?You must specify what is to be logged
        !           444: Text of login scriptName under which to store the file, or CR
        !           445: You have to 'set line' first
        !           446: Remote Kermit server command?You must specify a command for the remote server
        !           447: File(s) to send?A file specification is required
        !           448: Name to send it withParameter?You must specify a parameter to set
        !           449: Unix shell command to execute/bin/sh-i-cparameters
        !           450: Versions:
        !           451:  %s
        !           452:  %s
        !           453:  %s
        !           454:  %s
        !           455:  %s
        !           456:  %s
        !           457:  %s
        !           458:  %s
        !           459: 
        !           460: 
        !           461: Nothing to show...
        !           462: ?Take files nested too deeply
        !           463: C-Kermit command file?A file specification is required
        !           464: ?Wildcards not allowed in command file name
        !           465: rNot available - %s
        !           466: 1}��/u��0_q��A���#Y���`������,-C���^��2 t � !M!�!�!�!"d"e"�"v#w#Q$�$%a%�%�%�%&e&�&�&�&�&='�'�'�':(q(�()H)�)�)**[*�*�*8+t+
        !           467:   Usage: kermit [-x arg [-x arg]...[-yyy]..]]
        !           468:    x is an option that requires an argument, y an option with no argument:
        !           469:      actions (* options also require -l and -b) --
        !           470:        -s file(s)   send (use '-s -' to send from stdin)
        !           471:        -r           receive
        !           472:        -k           receive to stdout
        !           473:      * -g file(s)   get remote file(s) from server (quote wildcards)
        !           474:        -a name      alternate name, used with -s, -r, -g
        !           475:        -x           enter server mode
        !           476:      * -f           finish remote server
        !           477:      * -c           connect before transaction
        !           478:      * -n           connect after transaction
        !           479:      settings --
        !           480:        -l line      communication line device
        !           481:        -b baud      line speed, e.g. 1200
        !           482:        -i           binary file or Unix-to-Unix (text by default)
        !           483:        -p x         parity, x is one of e,o,m,s,n
        !           484:        -t           line turnaround handshake = xon, half duplex
        !           485:        -w           don't write over preexisting files
        !           486:        -q           be quiet during file transfer
        !           487:        -d           log debugging info to debug.log
        !           488:        -e length    (extended) receive packet length
        !           489:  If no action command is included, enter interactive dialog.
        !           490: 
        !           491: Type ? for a list of commands, type 'help x' for any command x.
        !           492: While typing commands, use the following special characters:
        !           493: 
        !           494:  DEL, RUBOUT, BACKSPACE, CTRL-H: Delete the most recent character typed.
        !           495:  CTRL-W: Delete the most recent word typed.
        !           496:  CTRL-U: Delete the current line.
        !           497:  CTRL-R: Redisplay the current line.
        !           498:  ?       (question mark) display help on the current command or field.
        !           499:  ESC     (Escape or Altmode) Attempt to complete the current field.
        !           500:  \       (backslash) include the following character literally.
        !           501: 
        !           502: From system level, type 'kermit -h' to get help about command line args.
        !           503: Shut down and log out a remote Kermit serverClose one of the following logs:
        !           504:  session, transaction, packet, debugging -- 'help log' for further info.Connect to a remote system via the tty device given in the
        !           505: most recent 'set line' commandFormat: 'get filespec'.  Tell the remote Kermit server to send the named
        !           506: files.  If filespec is omitted, then you are prompted for the remote and
        !           507: local filenames separately.Record information in a log file:
        !           508: 
        !           509:  debugging             Debugging information, to help track down
        !           510:   (default debug.log)  bugs in the C-Kermit program.
        !           511: 
        !           512:  packets               Kermit packets, to help track down protocol problems.
        !           513:   (packet.log)
        !           514: 
        !           515:  session               Terminal session, during CONNECT command.
        !           516:   (session.log)
        !           517: 
        !           518:  transactions          Names and statistics about files transferred.
        !           519:   (transact.log)
        !           520: Syntax: script text
        !           521: 
        !           522: Login to a remote system using the text provided.  The login script
        !           523: is intended to operate similarly to uucp "L.sys" entries.
        !           524: A login script is a sequence of the form:
        !           525: 
        !           526:       expect send [expect send] . . .
        !           527: 
        !           528: where 'expect' is a prompt or message to be issued by the remote site, and
        !           529: 'send' is the names, numbers, etc, to return.  The send may also be the
        !           530: keyword EOT, to send control-d, or BREAK, to send a break.  Letters in
        !           531: send may be prefixed by ~ to send special characters.  These are:
        !           532: ~b backspace, ~s space, ~q '?', ~n linefeed, ~r return, ~c don't
        !           533: append a return, and ~o[o[o]] for octal of a character.  As with some 
        !           534: uucp systems, sent strings are followed by ~r unless they end with ~c.
        !           535: 
        !           536: Only the last 7 characters in each expect are matched.  A null expect,
        !           537: e.g. ~0 or two adjacent dashes, causes a short delay.  If you expect
        !           538: that a sequence might not arrive, as with uucp, conditional sequences
        !           539: may be expressed in the form:
        !           540: 
        !           541:       -send-expect[-send-expect[...]]
        !           542: 
        !           543: where dashed sequences are followed as long as previous expects fail.
        !           544: Format: 'receive [filespec]'.  Wait for a file to arrive from the other
        !           545: Kermit, which must be given a 'send' command.  If the optional filespec is
        !           546: given, the (first) incoming file will be stored under that name, otherwise
        !           547: it will be stored under the name it arrives with.Format: 'send file1 [file2]'.  File1 may contain wildcard characters '*' or
        !           548: '?'.  If no wildcards, then file2 may be used to specify the name file1 is
        !           549: sent under; if file2 is omitted, file1 is sent under its own name.Enter server mode on the currently selected line.  All further commands
        !           550: will be taken in packet form from the other Kermit program.The 'set' command is used to establish various communication or file
        !           551: parameters.  The 'show' command can be used to display the values of
        !           552: 'set' parameters.  Help is available for each individual parameter;
        !           553: type 'help set ?' to see what's available.
        !           554: Type of packet block check to be used for error detection, 1, 2, or 3.
        !           555: Type 1 is standard, and catches most errors.  Types 2 and 3 specify more
        !           556: rigorous checking at the cost of higher overhead.  Not all Kermit programs
        !           557: support types 2 and 3.
        !           558: set file: names, type, warning, display.
        !           559: 
        !           560: 'names' are normally 'converted', which means file names are converted
        !           561: to 'common form' during transmission; 'literal' means use filenames
        !           562: literally (useful between like systems).
        !           563: 
        !           564: 'type' is normally 'text', in which conversion is done between Unix
        !           565: newlines and CRLF line delimiters; 'binary' means to do no conversion.
        !           566: Use 'binary' for executable programs or binary data.
        !           567: 
        !           568: 'warning' is 'on' or 'off', normally off.  When off, incoming files will
        !           569: overwrite existing files of the same name.  When on, new names will be
        !           570: given to incoming files whose names are the same as existing files.
        !           571: 
        !           572: 'display' is normally 'on', causing file transfer progress to be displayed
        !           573: on your screen when in local mode.  'set display off' is useful for
        !           574: allowing file transfers to proceed in the background.
        !           575: 
        !           576: The 'remote' command is used to send file management instructions to a
        !           577: remote Kermit server.  There should already be a Kermit running in server
        !           578: mode on the other end of the currently selected line.  Type 'remote ?' to
        !           579: see a list of available remote commands.  Type 'help remote x' to get
        !           580: further information about a particular remote command 'x'.
        !           581: Change Working Directory, equivalent to Unix 'cd' commandDelete a local file or filesDial a number using modem autodialerDisplay a directory of local filesDisplay the rest of the command on the terminal,
        !           582: useful in command files.Exit from the Kermit program, closing any open logs.Tell the remote Kermit server to shut down without logging out.Hang up the phone.Remote commandParameterIssue a command to the Unix shell (space required after '!')Display current values of 'set' parameters; 'show version' will display
        !           583: program version information for each of the C-Kermit modules.Display disk usage in current device, directoryDisplay statistics about most recent file transferTake Kermit commands from the named file.  Kermit command files may
        !           584: themselves contain 'take' commands, up to a reasonable depth of nesting.Not available yet - %s
        !           585: Number of seconds to wait before sending first packet after 'send' command.During 'connect': 'full' means remote host echoes, 'half' means this programdoes its own echoing.%sDecimal ASCII value for escape character during 'connect', normally 28
        !           586: (Control-\)
        !           587: Type of flow control to be used.  Choices are 'xon/xoff' and 'none'.normally xon/xoff.Decimal ASCII value for character to use for half duplex line turnaroundhandshake.  Normally, handshaking is not done.Device name of communication line to use.  Normally %s.
        !           588: If you set the line to other than %s, then Kermit
        !           589: will be in 'local' mode; 'set line' will reset Kermit to remote mode.
        !           590: If the line has a modem, and if the modem-dialer is set to direct, thiscommand causes waiting for a carrier detect (e.g. on a hayes type modem).This can be used to wait for incoming calls.To use the modem to dial out, first set modem-dialer (e.g., to hayes), thenset line, next issue the dial command, and finally connect.Type of modem for dialing remote connections.  Needed to indicate modem canbe commanded to dial without 'carrier detect' from modem.  Many recentlymanufactured modems use 'hayes' protocol.  Type 'set modem ?' to see whattypes of modems are supported by this program.Parity to use during terminal connection and file transfer:even, odd, mark, space, or none.  Normally none.Prompt string for this program, normally 'C-Kermit>'.How many times to retransmit a particular packet before giving upCommunication line speed for external tty line specified in most recent'set line' command.  Any of the common baud rates: 0, 110, 150, 300, 600, 1200, 1800, 2400, 4800, 9600, 19200.Specify parameters for inbound packets:End-Of-Packet (ASCII value), Packet-Length (1000 or less),Padding (amount, 94 or less), Pad-Character (ASCII value),Start-Of-Packet (ASCII value), and Timeout (94 seconds or less),all specified as decimal numbers.Specify parameters for outbound packets:End-Of-Packet (ASCII value), Packet-Length (2000 or less),Padding (amount, 94 or less), Pad-Character (ASCII value),Start-Of-Packet (ASCII value), and Timeout (94 seconds or less),all specified as decimal numbers.%sNot available yet - %s
        !           591: Ask remote Kermit server to change its working directory.Ask remote Kermit server to delete the named file(s).Ask remote Kermit server to provide directory listing of the named file(s).Ask remote Kermit server to tell you what services it provides.Send a command to the remote system in its own command language
        !           592: through the remote Kermit server.Ask the remote Kermit server to tell you about its disk space.Ask the remote Kermit server to type the named file(s) on your screen.Ask the remote Kermit server to list who's logged in, or to give information
        !           593: about the specified user.%snot working yet - %s
        !           594: %s- Sorry, debug log not available
        !           595: Name of packet log filepacket.logName of session log filesession.log%s- Sorry, transaction log not available
        !           596: 
        !           597: ?Unexpected log designator - %d
        !           598: Communications Parameters: Line: %s, speed: %d, mode: localremote, modem-dialer: %s
        !           599:  Bits: %d, parity: evenoddmarkspacenoneinvalid - %d, duplex: half, full, flow: xon/xoffnone%d, handshake: %d
        !           600: none
        !           601: Terminal emulation: %d bits
        !           602: 
        !           603: Protocol Parameters:   Send    Receive    (* = override)
        !           604:  Timeout:      %11d%9d*
        !           605:  Padding:      %11d%9d        Block Check: %6d
        !           606:  Pad Character:%11d%9d        Delay:       %6d
        !           607:  Packet Start: %11d%9d        Max Retries: %6d
        !           608:  Packet End:   %11d%9d        8th-Bit Prefix: '%c'
        !           609:  Packet Length:%11d* %8d (94)        Repeat Prefix:  '%c'
        !           610:  Length Limit: %11d%9d
        !           611: 
        !           612: File parameters:
        !           613:  File Names:   %-12sconverted%-12sliteral
        !           614:  File Type:    %-12sbinary%-12stext   Packet Log:       none
        !           615:  File Warning: %-12son%-12soff   Session Log:      none
        !           616:  File Display: %-12soff%-12son
        !           617: 
        !           618: File Byte Size: %d, Incomplete File Disposition: keepdiscard, Init file: %s.kermrc
        !           619: 
        !           620: Most recent transaction --
        !           621:  files: %ld
        !           622:  total file characters  : %ld
        !           623:  communication line in  : %ld
        !           624:  communication line out : %ld
        !           625:  elapsed time           : %d sec
        !           626:  effective baud rate    : %ld
        !           627:  efficiency             : %ld %%
        !           628:  packet length          : %d (send), %d (receive)
        !           629:  block check type used  : %d
        !           630:  compression            : yes [%c]
        !           631: no
        !           632:  8th bit prefixing      : yes [%c]
        !           633: no
        !           634: 
        !           635: 
        !           636: �@&�@�@�@�@&�@�@�@&�@�@�@&AAA'A/A4A&=ABA
EAIA
        !           637: LA�QAVAZA&dAlA&sAxAe}Am�A�Ao�As�A�A&�A�A&�A123fullhalfdisplaynamestypewarningend-of-packetpacket-lengthpad-characterpaddingstart-of-packettimeoutnonexon/xoffbellcresclfnonexoffxonconvertedliteralbinarytextevenmarknoneoddspaceoffondiscardkeepbytesize...Use 'set send' or 'set receive' instead.
        !           638: Type 'help set send' or 'help set receive' for more info.
        !           639: discardDevice nameSorry, can't open line1Number of seconds before starting to send5fullDecimal ASCII code for escape characterFile parameterhow to handle filenamesconvertedtype of filetextfile byte size (7 or 8)8
        !           640: ?The choices are 7 and 8
        !           641: ?unexpected file parameter
        !           642: xon/xoffnonetype of modem, direct means nonedirectnoneProgram's command promptC-Kermit>Maximum retries per packet10bytesizebytesize for terminal connection8
        !           643: ?The choices are 7 and 8
        !           644: Parameter for inbound packetsParameter for outbound packetsDecimal ASCII code for packet terminator13Maximum number of characters in a packet90Extended-length packets requested
        !           645: Decimal ASCII code for packet-start character1How many padding characters for inbound packets0Decimal ASCII code for inbound pad character0Interpacket timeout interval5
        !           646: Speed setting can only be done on an external line
        !           647: You must 'set line' before issuing this command
        !           648: Baud rate for %s?Unsupported line speed - %d
        !           649: %s: %d baud
        !           650: Not working yet - %s
        !           651: on
        !           652: ?Sorry, %d is the maximum
        !           653: 
        !           654: ?Not in ASCII control range - %d
        !           655: Remote directory nametake file ends prematurely in 'remote cwd' Password: ? Password of remote directory
        !           656:  Password: Name of remote file(s) to deleteRemote directory or file specificationCommand for remote systemRemote file(s) to print on remote printerConfirm, or remote directory nameRemote file specificationRemote user name, or carriage returnnot working yet - %s
        !           657: ?File specification required
        !           658: => , Size: %ld [OK] [discarded] [interrupted]Skipping *** screen() called with bad status ***%s: %ld%s: %ld*** screen() called with bad object ***CTRL-F to cancel file,  CTRL-R to resend current packetCTRL-B to cancel batch, CTRL-A for status report:  ^A  Status report: file type: binarytext file number characters  block check compression 8th-bit prefixing^B - Cancelling Batch ^F - Cancelling File ^R - Resending  [Ignored] �V
        !           659: W��''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''&'''''''''''''''''''''''''''''''''''''''''&''''''''''��''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''
        !           660: '''''''''''''''''''        '''''''''''''''''''''&''''''''''��'''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''&'''''''''''''''''''''''''''''''''''''''&''''''''''��'''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''&'''''''''''''''''''' ''''''''''''''''''''&''''''''''��''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''&'''''''''''''''''''!'''''''''''''''''''''&''''''''''��''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''&'''''''''''''''''''"'''''''''''''''''''''&''''''''''��''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''&'''''''''''''''''''#'''''''''''''''''''''&''''''''''��''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''&'''''''''''''''''''$'''''''''''''''''''''&''''''''''��''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''&'''''''''''''''''''%'''''''''''''''''''''&''''''''''��
&��&��''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''&'''''''''''''''''''''''''''''''''''''''&''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''&'''''''''''''''''''''''''''''''''''''&''''''''''Wart Version 1A(006) Jan 1989C-Kermit Protocol Module 4E(032), 13 Jan 89User cancelled transactionCan't do system commandUnimplemented server functionCan't change directoryCan't list directoryCan't remove fileCan't send helpCan't type fileCan't check spaceCan't do who commandUnimplemented generic server functionCan't open fileXZCan't close fileCan't execute commandCan't open fileDCan't open fileProtocol errorUnknown packet typeSorry, you must 'set speed' firstCan't open lineCan't condition lineEntering server mode on Escape back to your local system and give a SEND command...Escape back to your local system and give a RECEIVE command...C-Kermit server done�YC-Kermit functions, 4E(054) 13 Jan 89Too many filesFile not foundFile not foundNo readable file to sendNo readable file to sendstdinNONAMECan't open fileCan't open filehelp text�����  
        !           661: ������������!"�$��'(��+�-.�0��3�56��9:�<��?�AB�D��GH��K�MN�P��S�UV��YZ�\��_`��c�ef��ij�l��o�qr�t��wx��{�}~��!�1B�Rc�s���
        !           662: ���ƍ����#�2$F�W6e�tH���Z�Ӿl���~���Timed out.s-(resend)s-(resend)User typed ^Cr-�[�]^^4^Y^j^y^�^Connect Command for Unix, V4E(017) 14 Sep 87Sorry, you must 'set line' first
        !           663: Sorry, you must 'set speed' first
        !           664: Your escape character is not ASCII - %d
        !           665: Sorry, can't open %sConnecting thru %s, speed %d.
        !           666: The escape character is %s (%d).
        !           667: Type the escape character followed by C to get back,
        !           668: or followed by ? to see other options.
        !           669: (Session logged to %s.)
        !           670: Sorry, can't condition console terminal
        !           671: Sorry, Can't condition communication line
        !           672: Can't create keyboard fork[Back at Local System]
        !           673: 
        !           674: Can't send character
[Back at Local System]
        !           675: 
        !           676: Communications disconnect 
        !           677: Can't get character
        !           678:   C to close the connection, or:
        !           679:   0 (zero) to send a null
        !           680:   B to send a BREAK
        !           681:   H to hangup and close connection
        !           682:   S for status
        !           683:   ? for help
        !           684:  escape character twice to send the escape character.
        !           685: 
        !           686: Command>CTRL-%c'%c'
        !           687: 
        !           688: 
        !           689: 
        !           690: Connected thru , speed %d, %d bits, evenoddspacemark parity, logging to P_q_&z_����Unix tty I/O, 4E(048), 13 Jan 89/dev/tty/dev/ttyExclusive access to %s denied
        !           691: Warning, problem getting exclusive access
        !           692: Warning, problem releasing lock
        !           693: Warning, problem hanging up the phone
        !           694: Warning, problem relinquishing exclusive access
        !           695: stty/usr/spool/uucpLCK..Warning, read access to lock directory denied
        !           696: /ls -l (You may type "! rm %s" to remove this file)
        !           697: Warning, write access to lock directory denied
        !           698: Unsupported line speed - %d
        !           699: Current speed not changed
        !           700: flush failed^C...
        !           701: 
        !           702: ta�a�a�a�a�a�a�aUnix file support, 4E(038) 24 Jan 89rm -f pwd cat ls -l df df who Terminal input not allowedrzopeniwzopeno can't open
        !           703: ?File number out of range - %d
        !           704: ./HOMEHOME(directory unknown)/bin/sh/dev/null-cr~%dmalloc fails in splitpath()././d6d=d�EdFdGdHd�QdSdVdWdXdYd\d^d`dadbdcdgdjdldmdndod sdud�&xdzd}dd#�d�d�d�d�d�d2�d�d,&�d�d�d�d#�d�d2�d�d�d�d�d�d�d�d�d�d�d�d�d�d�d�d�d�d,&�d�d�d�d#�d�d�d�d�d�d�d�d�de&ee<ee
        !           705: eeeexb�b�b�b�b�b�bcc,c@cTchc|ce
%e&.e6e>eKeXe_ekeqexe�e�e        �e
        !           706: �e�e�e�e�e�eDial Command, V2.0(010) 15 Jan 89BbPpTt  XYR
D '%s'
=&%s=&%s#=W%s!%

$D
:T%s
,AT
ATD%s


>k
:%s
Kk
*D
?%s
%s
,ATS2=01
OK
ATTD%s
%


$<K%s
>,

CDS ><D M%s
>%s


MODIFY?CALL %s
att7300cermetekconcorddf03-acdf100-seriesdf200-seriesdirectgendatacommhayespenrilracalvadicrolmunknownusrobotics-212aventelUnknownTimeoutInterruptModemInitializeSorry, you must 'set modem' first
        !           707: Sorry, you must 'set line' first
        !           708: Sorry, you must 'set speed' first
        !           709: Sorry, can't open %sDialing thru %s, speed %d, number %s.
        !           710: The timeout for completing the call is %d seconds.
        !           711: Type the interrupt character (^C) to cancel the dialing.
        !           712: Sorry, Can't hang up tty line
        !           713: Sorry, Can't condition communication line
        !           714: %s failure while handling failure.
        !           715: No connection made within the allotted time.
        !           716: Dialing interrupted.
        !           717: Failed ("").
        !           718: Cannot initialize modem.
        !           719: No ConnectionAU 1
AttachedBusyDisconnectedErrorNo answerNo dial toneSpeed:ON LINENO CONNECTCONNECTNO CARRIEROKBUSYNO RINGON LINEFAILED CALLCALLINGCOMPLETEFAILEDNOT AVAILABLELACKS PERMISSIONONLINE!BUSYDEAD PHONEINITIATINGBUSYCALL FAILEDCall completed.
        !           720: �hScript Command, V2.0(007) 3 Aug 87EOT{EOT}BREAK{BREAK}Sorry, you must 'set line' first
        !           721: Sorry, you must 'set speed' first
        !           722: Sorry, can't open %sExecuting script thru %s, speed %d.
        !           723: Script string: %s
        !           724: Sorry, Can't condition communication line
        !           725: Script successful.
        !           726: Sorry, script failed
        !           727: ^%c%c/etc/passwdrBad error number: 
        !           728: �j�j�j�j�j�j�jk k2kBkNk`krk�k�k�k�k�k�k�k�kll)l=lNlXlgll�l�l�l�l�l�l�lmm)m(not the super userno such file or directoryno such processinterrupted system callI/O errorno such device or addressarg list too longexec format errorbad file numberno childrenno more processesnot enough memorypermission deniedbad addressblock device requiredmount device busyfile existscross-device linkno such devicenot a directoryis a directoryinvalid argumentfile table overflowtoo many open filesnot a typewriterfile busyfile too largeno space left on deviceillegal seekread-only file systemtoo many linksbroken pipemath argumentresult too largeout of kernel spacedriver not loadedbad exec formatdevice needs attentiondevice busy/bin/shsh-c/dev/console/etc/ttysr@@@@@@@@@PPPPP@@@@@@@@@@@@@@@@@@�                                                                      &&&&&&&&&&&&&&&&&&&&      
        !           729: 
        !           730: 
        !           731: 
        !           732: 
        !           733: 
        !           734:     @Bad pointer in malloc.
        !           735: Bad pointer in free.
        !           736: 
        !           737: You must compile with the -f flag to include printf() floating point.
        !           738: o$o4o&�@�&&�@�&&&�@�����������������������������������������

unix.superglobalmegacorp.com

This archive runs on limited infrastructure. Preserving old code on modern bandwidth. Automated agents are requested to crawl responsibly.