Return to helpfile CVS log

Up to [MW Coherent from dump] / coherent / f / etc

Annotation of coherent/f/etc/helpfile, revision 1.1

1.1     ! root        1: #ac
        !             2: aacc -- Summarize login accounting information
        !             3: 
        !             4: aacc [ -ddpp ] [ -ww _w_f_i_l_e ][ _u_s_e_r_n_a_m_e ... ]
        !             5: 
        !             6: _O_p_t_i_o_n_s:
        !             7:      -dd        Itemize for each midnight-midnight period
        !             8:      -pp        Itemize by individual users
        !             9:      -ww _w_t_m_p   Obtain raw statistics from _w_t_m_p rather than /uussrr/aaddmm/wwttmmpp
        !            10: 
        !            11: If users are specified, only they are considered.
        !            12: #accton
        !            13: aaccccttoonn -- Enable/disable process accounting
        !            14: 
        !            15: /eettcc/aaccccttoonn [ _f_i_l_e ]
        !            16: 
        !            17: Normally _f_i_l_e is /uussrr/aaddmm/aacccctt.  If no _f_i_l_e argument is included, disable
        !            18: process accounting.
        !            19: #alias
        !            20: aalliiaass -- Set an alias
        !            21: 
        !            22: aalliiaass [_n_a_m_e[=_v_a_l_u_e ...]]
        !            23: 
        !            24: kksshh only.
        !            25: #aliases
        !            26: aalliiaasseess -- File of users' aliases
        !            27: 
        !            28: /uussrr/lliibb/mmaaiill/aalliiaasseess
        !            29: $HHOOMMEE/.aalliiaasseess
        !            30: $HHOOMMEE/.ffoorrwwaarrdd
        !            31: 
        !            32: #ar
        !            33: aarr -- The librarian/archiver
        !            34: 
        !            35: aarr _o_p_t_i_o_n [_m_o_d_i_f_i_e_r][_p_o_s_i_t_i_o_n] _a_r_c_h_i_v_e [_m_e_m_b_e_r ...]
        !            36: 
        !            37: _O_p_t_i_o_n_s:
        !            38:      dd         Delete given members
        !            39:      mm         Move member to indicated position (default, end)
        !            40:      pp         Print members
        !            41:      qq         Quick append, put members at end with no checking
        !            42:      rr         Replace each member specified in the archive
        !            43:      tt         Print a table of members (default, all)
        !            44:      xx         Extract the specified members (default, all)
        !            45: _M_o_d_i_f_i_e_r_s:
        !            46:      aa         Place new member after _p_o_s_i_t_i_o_n in archive
        !            47:      bb         Place new member before _p_o_s_i_t_i_o_n in archive
        !            48:      cc         Suppress message when new archive is created
        !            49:      ii         Insert new member before _p_o_s_i_t_i_o_n in archive
        !            50:      kk         Preserve modify time of file (with options rr, qq, or xx)
        !            51:      ll         Use current directory for temporaries (default, /ttmmpp)
        !            52:      ss         Update ranlib header even if not present (with options rr or mm)
        !            53:      uu         Update: replace members only if newer than those in archive
        !            54:      vv         Print extra information when used with certain options
        !            55: #as 286
        !            56: aass 228866 -- i80286 assembler
        !            57: 
        !            58: aass [-ggllxx] [ -oo_f_i_l_e ] _f_i_l_e ...
        !            59: 
        !            60: _O_p_t_i_o_n_s:
        !            61:      -gg        Make all undefined symbols global
        !            62:      -ll        Output listing to standard output
        !            63:      -oo _d_e_s_t   Rename output file _d_e_s_t (default, ll.oouutt)
        !            64:      -xx        Strip local symbols from symbol table
        !            65: #as 386
        !            66: aass 338866 -- i80386 assembler
        !            67: 
        !            68: aass [-oo _o_u_t_f_i_l_e] [-bbffggllnnppwwxxXX] _i_n_f_i_l_e
        !            69: 
        !            70: _O_p_t_i_o_n_s:
        !            71:      -bb        Reverse bracket sense; that is, use () for expressions and []
        !            72:                for code.
        !            73:      -ff        Reverse order of operands from UNIX assembler form to that of
        !            74:                Intel documentation or 80286 version of aass.
        !            75:      -gg        Make undefined symbols .gglloobbll.
        !            76:      -ll        Generate output listing.
        !            77:      -nn        Turn off the insertion of nnoopps to correct 80386 errors.
        !            78:      -oo _o_u_t_f_i_l_e
        !            79:                Name the file into which the relocatable object is written
        !            80:      -pp        Don't use `%' on register names; e.g., use aaxx, not %aaxx.
        !            81:      -QQ        Quiet: Suppress all error messages, no matter how awful an error
        !            82:                they indicate
        !            83:      -ww        Disable warning messages.
        !            84:      -xx        Remove all non-global symbols from the common symbol output.
        !            85:      -XX        Remove all non-global symbols starting with .LL from the common
        !            86:                symbol output.
        !            87: 
        !            88: Options and file names can be interspersed on the command line.
        !            89: 
        !            90: The 80386 version of aass assembles files written in the 80286 dialect of aass or
        !            91: UNIX-style assembly language.  It generates relocatable object modules that can
        !            92: be linked with objects compiled by the COHERENT C compiler.  It also contains a
        !            93: number of features not available with the 80286 dialect of aass, including macro
        !            94: assembly.
        !            95: #asfix
        !            96: aassffiixx -- Convert assembly-language programs into as 80386 format
        !            97: 
        !            98: aassffiixx < _o_l_d_f_i_l_e > _n_e_w_f_i_l_e
        !            99: 
        !           100: #at
        !           101: aatt -- Execute commands at given time
        !           102: 
        !           103: aatt [ -vv ] [ -cc _c_o_m_m_a_n_d ] _t_i_m_e [ [ _d_a_y ] _w_e_e_k ] [ _f_i_l_e ]
        !           104: aatt [ -vv ] [ -cc _c_o_m_m_a_n_d ] _t_i_m_e _m_o_n_t_h _d_a_y [ _f_i_l_e ]
        !           105: 
        !           106: _O_p_t_i_o_n_s:
        !           107:      -cc        Following argument gives command
        !           108:      -vv        Print time for which command is set
        !           109: 
        !           110: If _f_i_l_e is given, read commands from it.  If neither _f_i_l_e nor -cc is given, read
        !           111: commands from stdin.
        !           112: #ATclock
        !           113: AATTcclloocckk -- Read or set the AT realtime clock
        !           114: 
        !           115: /eettcc/AATTcclloocckk [_y_y[_m_m[_d_d[_h_h[_m_m[._s_s]]]]]]
        !           116: 
        !           117: With an argument, AATTcclloocckk sets your computer's realtime clock.  With no
        !           118: argument, it reads it.
        !           119: #atrun
        !           120: aattrruunn -- Execute commands at a preset time
        !           121: 
        !           122: 
        !           123: #awk
        !           124: aawwkk -- Pattern-scanning language
        !           125: 
        !           126: aawwkk [-yy][-FF_c][-ff _p_r_o_g_f_i_l_e][_p_r_o_g][_f_i_l_e ...]
        !           127: 
        !           128: _O_p_t_i_o_n_s:
        !           129:      -FF_c       Set field separator character to _c (default, blank, and tab)
        !           130:      -ff        _p_r_o_g_f_i_l_e is the aawwkk program; otherwise, first non-option
        !           131:                argument is aawwkk program
        !           132:      -yy        Dual case match (as in ggrreepp)
        !           133: 
        !           134: If no _f_i_l_e is present, the stdin is used.  File `-' means stdin.
        !           135: #bad
        !           136: bbaadd -- Maintain list of bad blocks
        !           137: 
        !           138: bbaadd _o_p_t_i_o_n _f_i_l_e_s_y_s_t_e_m [ block ... ]
        !           139: 
        !           140: _O_p_t_i_o_n_s:
        !           141:      aa         Add blocks
        !           142:      cc         Clear bad-block list
        !           143:      dd         Delete blocks
        !           144:      ll         List blocks
        !           145: #badscan
        !           146: bbaaddssccaann -- Build bad block list
        !           147: 
        !           148: /eettcc/bbaaddssccaann [ -vv ] [ -oo _p_r_o_t_o ] [ -bb _b_o_o_t ] _d_e_v_i_c_e _s_i_z_e
        !           149: /eettcc/bbaaddssccaann [ -vv ] [ -oo _p_r_o_t_o ] [ -bb _b_o_o_t ] _d_e_v_i_c_e _x_d_e_v_i_c_e
        !           150: 
        !           151: _O_p_t_i_o_n_s:
        !           152:      -bb _b_o_o_t   Insert bootstrap _b_o_o_t into _p_r_o_t_o
        !           153:      -oo _p_r_o_t_o  Write prototype into file _p_r_o_t_o
        !           154:      -vv        Print estimate of time remaining
        !           155: 
        !           156: Scan _d_e_v_i_c_e of _s_i_z_e bytes (or size given in hard disk partition table _x_d_e_v_i_c_e)
        !           157: for bad blocks, write prototype to stdout.
        !           158: #banner
        !           159: bbaannnneerr -- Print large letters
        !           160: 
        !           161: bbaannnneerr [ _a_r_g_u_m_e_n_t ... ]
        !           162: 
        !           163: Print each _a_r_g_u_m_e_n_t as one line of large-text output.  If no arguments, print
        !           164: each line from stdin as a line of large output.
        !           165: #basename
        !           166: bbaasseennaammee -- Strip path information from a file name
        !           167: 
        !           168: bbaasseennaammee _f_i_l_e [ _s_u_f_f_i_x ]
        !           169: 
        !           170: #bc
        !           171: bbcc -- Interactive calculator with arbitrary precision
        !           172: 
        !           173: bbcc [ -ll ] [ _f_i_l_e ... ]
        !           174: 
        !           175: _O_p_t_i_o_n:
        !           176:      -ll        Use the extended bbcc library
        !           177: 
        !           178: If no _f_i_l_e is specified, bbcc reads stdin.
        !           179: #bind
        !           180: bbiinndd -- Bind key sequence to editing command
        !           181: 
        !           182: bbiinndd [-mm] [_s_t_r_i_n_g [= _c_o_m_m_a_n_d]]
        !           183: 
        !           184: _O_p_t_i_o_n:
        !           185:      -mm        Bind multiple commands to one keystroke
        !           186: 
        !           187: With no arguments, bbiinndd displays all current bindings.  kksshh only.
        !           188: #boottime
        !           189: bboooottttiimmee -- File that holds time system was last booted
        !           190: 
        !           191: 
        !           192: #brc
        !           193: bbrrcc -- Perform maintenance chores, single-user mode
        !           194: 
        !           195: /eettcc/bbrrcc
        !           196: 
        !           197: #break
        !           198: bbrreeaakk -- Exit from shell construct
        !           199: 
        !           200: bbrreeaakk [ _n ]
        !           201: 
        !           202: Exit from _n (default, one) ffoorr, uunnttiill, or wwhhiillee constructs.  The shell executes
        !           203: bbrreeaakk directly.
        !           204: #build
        !           205: bbuuiilldd -- Install COHERENT onto a hard disk
        !           206: 
        !           207: /eettcc/bbuuiilldd
        !           208: 
        !           209: #builtin
        !           210: bbuuiillttiinn -- Execute a command as a built-in command
        !           211: 
        !           212: bbuuiillttiinn _c_o_m_m_a_n_d [ _a_r_g ... ]
        !           213: 
        !           214: kksshh only.
        !           215: #c
        !           216: cc -- Print multi-column output
        !           217: 
        !           218: cc [ -ll_N ] [ -ww_N ] [ -001122 ]
        !           219: 
        !           220: _O_p_t_i_o_n_s:
        !           221:      -ll_N       Set the page length to _N lines
        !           222:      -ww_N       Set the page width to _N columns
        !           223:      -00        Order fields horizontally across the page
        !           224:      -11        Order fields vertically down each column (default)
        !           225:      -22        Special case of -1
        !           226: #cal
        !           227: ccaall -- Print a calendar
        !           228: 
        !           229: ccaall [ _m_o_n_t_h ] [ _y_e_a_r ]
        !           230: 
        !           231: #calendar
        !           232: ccaalleennddaarr -- Reminder service
        !           233: 
        !           234: ccaalleennddaarr [ -aa ] [ -ff_f_i_l_e ]... [ -dd[_d_a_t_e] ] [ -ww[_d_a_t_e] ] [ -mm[_m_o_n_t_h] ]
        !           235: 
        !           236: _O_p_t_i_o_n_s:
        !           237:      -aa        Search calendars of all users and send mail
        !           238:      -ff_f_i_l_e    Search each _f_i_l_e in order given
        !           239:      -dd[_d_a_t_e]  Print all entries matching _d_a_t_e
        !           240:      -ww[_d_a_t_e]  Print entries in the week beginning with _d_a_t_e
        !           241:      -mm[_m_o_n_t_h] Print entries in the given _m_o_n_t_h
        !           242: 
        !           243: The default calendar is $HHOOMMEE/.ccaalleennddaarr.  The default date is today.
        !           244: #captoinfo
        !           245: ccaappttooiinnffoo -- Convert termcap data to terminfo form
        !           246: 
        !           247: ccaappttooiinnffoo [_f_i_l_e_n_a_m_e]
        !           248: 
        !           249: #case
        !           250: ccaassee -- Execute commands conditionally according to pattern
        !           251: 
        !           252: ccaassee _t_o_k_e_n iinn [_p_a_t_t_e_r_n [|_p_a_t_t_e_r_n] ...) _s_e_q_u_e_n_c_e ;;] ... eessaacc
        !           253: 
        !           254: The shell executes ccaassee directly.
        !           255: #cat
        !           256: ccaatt -- Concatenate/print files
        !           257: 
        !           258: ccaatt [ -uu ][ _f_i_l_e ... ]
        !           259: 
        !           260: _O_p_t_i_o_n:
        !           261:      -uu        Do not buffer output in 512-byte blocks
        !           262: 
        !           263: File `-' indicates the standard input.  If no _f_i_l_e is specified, ccaatt reads
        !           264: stdin.
        !           265: #cc
        !           266: cccc -- C compiler
        !           267: 
        !           268: cccc [_c_o_m_p_i_l_e_r _o_p_t_i_o_n_s] _f_i_l_e .... [_l_i_n_k_e_r _o_p_t_i_o_n_s]
        !           269: 
        !           270: _O_p_t_i_o_n_s:
        !           271:      -BB[ssttrr]   Use backup compiler versions.
        !           272:      -cc        Compile only -- no load
        !           273:      -DD_n_a_m_e[=_v_a_l_u_e]
        !           274:                Tell ccpppp to define _n_a_m_e with _v_a_l_u_e
        !           275:      -EE        Run ccpppp only and send its output to stdout
        !           276:      -ff        Include floating point output routines in load
        !           277:      -IInnaammee    Tell ccpppp to look for header files in directory _n_a_m_e
        !           278:      -KK        Keep intermediate files
        !           279:      -LL_d_i_r_e_c_t_o_r_y
        !           280:                Tell the linker lldd to search ddiirreeccttoorryy for its libraries before
        !           281:                it searches the directories named in the environmental variable
        !           282:                LLIIBBPPAATTHH
        !           283:      -ll_n_a_m_e    Pass /lliibb/lliibb_n_a_m_e.aa to linker lldd
        !           284:      -MM_s_t_r     Use alternative machine versions
        !           285:      -NN[pp0011aabb22ssddllrrtt]_s_t_r
        !           286:                Rename specified pass to _s_t_r
        !           287:      -OO        Run peephole optimizer of C compiler
        !           288:      -qq[pp0011aabb22ss]
        !           289:                Quit after specified pass
        !           290:      -QQ        Quiet: suppress all error messages, no matter how awful an error
        !           291:                they indicate
        !           292:      -SS        Place C compiler assembler output in a .ss file
        !           293:      -TT_s_i_z_e    Tell cccc to use buffers of _s_i_z_e_n bytes each, instead of its
        !           294:                default 64-kilobytes buffers (COHERENT 386 only)
        !           295:      -tt[pp0011aabb22ssddllrrtt]
        !           296:                Take specified compiler phases.
        !           297:      -UU_n_a_m_e    Tell ccpppp to remove any initial definition of _n_a_m_e
        !           298:      -VV        Run verbosely
        !           299:      -VV_n_a_m_e    Toggle variant VV_n_a_m_e
        !           300: 
        !           301: Compiles files ending .cc; assembles files ending in .ss; passes other options
        !           302: and files to the linker lldd.
        !           303: #cd
        !           304: ccdd -- Change directory
        !           305: 
        !           306: ccdd _d_i_r_e_c_t_o_r_y
        !           307: 
        !           308: If no _d_i_r_e_c_t_o_r_y specified, $HHOOMMEE is assumed.  The shell executes ccdd directly.
        !           309: #cdmp
        !           310: ccddmmpp -- Dump COFF files into a readable form
        !           311: 
        !           312: ccddmmpp [-aaddllrrss] _f_i_l_e_n_a_m_e
        !           313: 
        !           314: _O_p_t_i_o_n_s:
        !           315:      -aa        Suppress auxiliary symbol entries
        !           316:      -dd        Suppress data dumps
        !           317:      -ll        Suppress line numbers
        !           318:      -rr        Suppress relocation entries
        !           319:      -ss        Suppress symbol entries
        !           320: #cgrep
        !           321: ccggrreepp -- Pattern search for C source programs
        !           322: 
        !           323: ccggrreepp [-ccllnnssAA] [-rr _n_e_w] _e_x_p_r_e_s_s_i_o_n _f_i_l_e ...
        !           324: 
        !           325: _O_p_t_i_o_n_s:
        !           326:      -AA        Build _e_r_r_o_r _l_i_s_t for interactive editing using MicroEMACS, like
        !           327:                -AA option to the cccc command.
        !           328:      -cc        Print all C comments
        !           329:      -ll        Return file where _e_x_p_r_e_s_s_i_o_n found
        !           330:      -nn        Prefix each line containing _e_x_p_r_e_s_s_i_o_n_s with its number in its
        !           331:                source file
        !           332:      -rr        Replaces each _e_x_p_r_e_s_s_i_o_n with _n_e_w
        !           333:      -ss        Print all C strings
        !           334: #chase
        !           335: cchhaassee -- Highly amusing video game
        !           336: 
        !           337: /uussrr/ggaammeess/cchhaassee [ -cc ] [ _s_p_e_e_d ]
        !           338: 
        !           339: _O_p_t_i_o_n_s:
        !           340:      -cc        Color video card
        !           341:      _s_p_e_e_d     Speed of game: the lower the number, the faster the speed
        !           342:                (default, 10)
        !           343: #check
        !           344: cchheecckk -- Check file system
        !           345: 
        !           346: cchheecckk [-ss] _f_i_l_e_s_y_s_t_e_m ...
        !           347: 
        !           348: _O_p_t_i_o_n:
        !           349:      -ss        Salvage as much as possible, given the problems detected
        !           350: #checklist
        !           351: cchheecckklliisstt -- File systems to check when booting COHERENT
        !           352: 
        !           353: /eettcc/cchheecckklliisstt
        !           354: 
        !           355: #chgrp
        !           356: cchhggrrpp -- Change the group owner of a file
        !           357: 
        !           358: cchhggrrpp _g_r_o_u_p _f_i_l_e ...
        !           359: 
        !           360: #chmod
        !           361: cchhmmoodd -- Change the modes of a file
        !           362: 
        !           363: cchhmmoodd +_m_o_d_e_s _f_i_l_e
        !           364: cchhmmoodd -_m_o_d_e_s _f_i_l_e
        !           365: 
        !           366: 
        !           367: Mode may be octal or a comma-separated symbolic list: [_w_h_i_c_h]_h_o_w_p_e_r_m...[,...]
        !           368: _w_h_i_c_h:
        !           369:      aa         User, group, and other permissions
        !           370:      gg         Group permissions
        !           371:      oo         Other permissions
        !           372:      uu         User permissions
        !           373: 
        !           374: Missing _w_h_i_c_h implies that `a', `g', `o', and `u' can be combined.
        !           375: _h_o_w:
        !           376:      =         Set permissions
        !           377:      +         Add permissions
        !           378:      -         Take away permissions
        !           379: _p_e_r_m:
        !           380:      gg         Current group permissions
        !           381:      oo         Current other permissions
        !           382:      rr         Read
        !           383:      ss         Setuid on execution
        !           384:      tt         Sticky bit (save text)
        !           385:      uu         Current user permissions
        !           386:      ww         Write
        !           387:      xx         Execute
        !           388: #chmog
        !           389: cchhmmoogg -- Change mode, owner, and group simultaneously
        !           390: 
        !           391: cchhmmoogg _m_o_d _o_w_n _g_r_p _f_i_l_e ...
        !           392: 
        !           393: #chown
        !           394: cchhoowwnn -- Change the owner of files
        !           395: 
        !           396: cchhoowwnn _o_w_n_e_r _f_i_l_e ...
        !           397: 
        !           398: #chroot
        !           399: cchhrroooott -- Change root directory
        !           400: 
        !           401: cchhrroooott _d_i_r_e_c_t_o_r_y _p_r_o_g_r_a_m ...
        !           402: 
        !           403: #ckermit
        !           404: cckkeerrmmiitt -- Interactive inter-system communication and file transfer
        !           405: 
        !           406: cckkeerrmmiitt [-aabbccddeeffgghhiikkllppqqrrssttwwxx] [ _f_i_l_e ... ]
        !           407: 
        !           408: _O_p_t_i_o_n_s
        !           409:      -aa _f_i_l_e_n_a_m_e
        !           410:                Give an alternate name to file
        !           411:      -bb _b_a_u_d_r_a_t_e
        !           412:                Set the baud rate of the device to _b_a_u_d_r_a_t_e
        !           413:      -cc        Connect
        !           414:      -dd        Use debug mode
        !           415:      -ee _n      Set the length of the packet to _n
        !           416:      -ff        Send a ``finish'' command to a remote server
        !           417:      -gg _f_i_l_e   Ask a remote system to send _f_i_l_e
        !           418:      -hh        Print help
        !           419:      -ii        Specify that the file being transferred is binary
        !           420:      -kk        Passively receive files
        !           421:      -ll _d_e_v_i_c_e Name the serial device to be used
        !           422:      -nn        Like -cc, but used after a protocol transaction has occurred
        !           423:      -pp _x      Set parity to _x
        !           424:      -qq        Quiet mode -- no messages
        !           425:      -rr        Receive files
        !           426:      -ss _f_i_l_e   Send _f_i_l_e
        !           427:      -tt        Specify half duplex
        !           428:      -ww        Write-protect -- avoid file-name collisions for incoming files
        !           429:      -xx        Begin server operation
        !           430: #clear
        !           431: cclleeaarr -- Clear the screen
        !           432: 
        !           433: cclleeaarr
        !           434: 
        !           435: #clri
        !           436: ccllrrii -- Clear i-node
        !           437: 
        !           438: /eettcc/ccllrrii _f_i_l_e_s_y_s_t_e_m _i_n_u_m_b_e_r ...
        !           439: 
        !           440: #cmp
        !           441: ccmmpp -- Compare bytes of two files
        !           442: 
        !           443: ccmmpp [-llss] _f_i_l_e_1 _f_i_l_e_2 [_s_k_i_p_1 _s_k_i_p_2]
        !           444: 
        !           445: _O_p_t_i_o_n_s:
        !           446:      -ll        Print byte number and bytes at each difference
        !           447:      -ss        Return status (print nothing)
        !           448: 
        !           449: If _f_i_l_e_1 is `-', use stdin.  If _s_k_i_p_1 and _s_k_i_p_2 are present, they are the
        !           450: number of bytes to skip before comparing _f_i_l_e_1 and _f_i_l_e_2, respectively.
        !           451: #col
        !           452: ccooll -- Remove reverse and half-line motions
        !           453: 
        !           454: ccooll [ -bbddffxx ][ -pp_n ]
        !           455: 
        !           456: _O_p_t_i_o_n_s:
        !           457:      -bb        Output device cannot backspace
        !           458:      -dd        Double spaced output
        !           459:      -ff        The output device can handle half lines (has precedence over -dd)
        !           460:      -pp_n       Set page buffer to _n lines (default, 128)
        !           461:      -xx        Suppress conversion of white space to tabs on output
        !           462: #comm
        !           463: ccoommmm -- Print common lines
        !           464: 
        !           465: ccoommmm [ -112233 ] _f_i_l_e_1 _f_i_l_e_2
        !           466: 
        !           467: _O_p_t_i_o_n_s:
        !           468:      -11        Suppress column 1
        !           469:      -22        Suppress column 2
        !           470:      -33        Suppress column 3
        !           471: 
        !           472: Column 1 has lines unique to _f_i_l_e_1; column 2 has lines unique to _f_i_l_e_2; column
        !           473: 3 has lines common to both files.  Both files should be sorted.
        !           474: #compress
        !           475: ccoommpprreessss -- Compress a file
        !           476: 
        !           477: ccoommpprreessss [ -ddffvvcc ] [ -bb_n_u_m ] [ -ww _t_m_p_f_i_l_e ] [ _f_i_l_e ... ] (COHERENT 286)
        !           478: ccoommpprreessss [ -ddffvvcc ] [ -bb_n_u_m ] [ _f_i_l_e ... ] (COHERENT 386)
        !           479: 
        !           480: _O_p_t_i_o_n_s:
        !           481:      -bb_n_u_m     Set compression to _n_u_m
        !           482:      -cc        Send output to ssttddoouutt
        !           483:      -dd        Decompress, rather than compress
        !           484:      -ff        Force output file, even if no space saved by compression
        !           485:      -vv        Verbose mode
        !           486:      -ww _t_m_p_f_i_l_e
        !           487:                Use _t_m_p_f_i_l_e as the workfile (default, /ddeevv/rraamm11).  COHERENT 286
        !           488:                only.
        !           489: #continue
        !           490: ccoonnttiinnuuee -- Terminate current iteration of shell construct
        !           491: 
        !           492: ccoonnttiinnuuee [ _n ]
        !           493: 
        !           494: Terminate current iteration of _n (default, one) ffoorr, uunnttiill, or wwhhiillee
        !           495: constructs.  The shell executes ccoonnttiinnuuee directly.
        !           496: #conv
        !           497: ccoonnvv -- Numeric base converter
        !           498: 
        !           499: ccoonnvv [_n_u_m_b_e_r]
        !           500: 
        !           501: If no _n_u_m_b_e_r is given, reads one number per line from stdin.
        !           502: #cp
        !           503: ccpp -- Copy a file
        !           504: 
        !           505: ccpp [ -dd ]  _o_l_d_n_a_m_e _n_e_w_n_a_m_e
        !           506: ccpp [ -dd ]  _f_i_l_e_1 ... _f_i_l_e_N _d_i_r_e_c_t_o_r_y
        !           507: 
        !           508: _O_p_t_i_o_n:
        !           509:      -dd        Preserve date (_m_t_i_m_e) on destination files.
        !           510: #cpdir
        !           511: ccppddiirr -- Copy directory hierarchy
        !           512: 
        !           513: ccppddiirr [_o_p_t_i_o_n ... ] _d_i_r_1 _d_i_r_2
        !           514: 
        !           515: _O_p_t_i_o_n_s:
        !           516:      -aa        Verbose file by file account on one line
        !           517:      -dd        Preserve last-modified date
        !           518:      -ee        Recover from errors and continue
        !           519:      -rr[_n]     _R_e_c_u_r _n levels only (default, one)
        !           520:      -ss_n_a_m_e    Suppress copy of _n_a_m_e, which is relative to _d_i_r_1
        !           521:      -tt        Test and report errors -- do not change anything
        !           522:      -uu        Update regular files if more recent
        !           523:      -vv        Verbose file by file account
        !           524: #cpio
        !           525: ccppiioo -- Archiving/backup utility
        !           526: 
        !           527: ccppiioo -oo[BBaaccvv]
        !           528: ccppiioo -ii[BBccddffmmrrttuuvv] [_p_a_t_t_e_r_n...]
        !           529: ccppiioo -pp[aaddllmmrruuvv] _d_i_r_e_c_t_o_r_y
        !           530: 
        !           531: _O_p_t_i_o_n_s:
        !           532:      -aa        Reset access time of input files after copying
        !           533:      -BB        Change size of a block
        !           534:      -cc        Write header information in ASCII rather than binary
        !           535:      -dd        Create directories as needed
        !           536:      -ff_p_a_t_t_e_r_n Copy all files except those matching _p_a_t_t_e_r_n
        !           537:      -ii        Read the standard input
        !           538:      -ll        Link files rather than copying them
        !           539:      -mm        Retain previous modification times
        !           540:      -oo_p_a_t_t_e_r_n Copy all files matching _p_a_t_t_e_r_n
        !           541:      -pp        Read stdin for files names to copy to destination
        !           542:      -rr        Interactively rename files
        !           543:      -tt        Print table of contents of an existing archive
        !           544:      -uu        Copy files unconditionally
        !           545:      -vv        Verbose output
        !           546: #cpp
        !           547: ccpppp -- C preprocessor
        !           548: 
        !           549: /lliibb/ccpppp [_o_p_t_i_o_n...] [_f_i_l_e...]
        !           550: 
        !           551: _O_p_t_i_o_n_s:
        !           552:      -DD_V_A_R_I_A_B_L_E
        !           553:                Define _V_A_R_I_A_B_L_E
        !           554:      -II _d_i_r    Search _d_i_r for header files
        !           555:      -oo _f_i_l_e   Write output into _f_i_l_e
        !           556:      -UU_V_A_R_I_A_B_L_E
        !           557:                Undefine _V_A_R_I_A_B_L_E
        !           558: #cron
        !           559: ccrroonn -- Execute commands periodically
        !           560: 
        !           561: /eettcc/ccrroonn&
        !           562: 
        !           563: cron -- execute commands periodically Usage:  /etc/cron& Options:  None cron is
        !           564: invoked only once, usually from /eettcc/rrcc.  Thereafter, it sleeps in the
        !           565: background, awaking periodically to check crontab files -- either the file
        !           566: /uussrr/lliibb/ccrroonnttaabb if it exists, or the files in directory
        !           567: /uussrr/ssppooooll/ccrroonn/ccrroonnttaabbss if /uussrr/lliibb/ccrroonnttaabb does not exist.
        !           568: 
        !           569: Entries in a crontab file consist of commands preceded by five fields; these
        !           570: represent minute (0-59), hour (0-23), day of the month (1-31), month (1-12),
        !           571: and day of the week (1-7).  An asterisk `*' in a field means all possible
        !           572: entries for that field.
        !           573: #crontab
        !           574: ccrroonnttaabb -- Copy a command file into the crontab directory
        !           575: 
        !           576: /uussrr/bbiinn/ccrroonnttaabb [-ll] [-rr] [-ff _f_i_l_e_n_a_m_e] [-mm[eedd]] [-uu_u_s_e_r]
        !           577: 
        !           578: _O_p_t_i_o_n:
        !           579:      -ff _f_i_l_e_n_a_m_e
        !           580:                Replace a user's command file.
        !           581:      -ll        List your command file.
        !           582:      -mm[eedd]    Enable/disable sending mail upon failure of a command within a
        !           583:                command file.
        !           584:      -rr        Remove user's command file.
        !           585:      -uu_u_s_e_r    Specify that the file being copied is to be applied to _u_s_e_r.
        !           586:                Only the superuser rroooott can execute this option.
        !           587: #crypt
        !           588: ccrryypptt -- Encrypt/decrypt text
        !           589: 
        !           590: ccrryypptt [_p_a_s_s_w_o_r_d]
        !           591: 
        !           592: Password is ten characters or fewer.  The same password encrypts and decrypts.
        !           593: #ctags
        !           594: ccttaaggss -- Generate tags and refs files for vi editor
        !           595: 
        !           596: ccttaaggss [-rr] _f_i_l_e_s...
        !           597: 
        !           598: #cut
        !           599: ccuutt -- Select portions of each line of its input
        !           600: 
        !           601: ccuutt -cc_l_i_s_t [_f_i_l_e ...]
        !           602: ccuutt -ff_l_i_s_t [-ss] [-dd _c_h_a_r] [_f_i_l_e ...]
        !           603: 
        !           604: _O_p_t_i_o_n_s:
        !           605:      -cc _l_i_s_t   _l_i_s_t specifies character positions
        !           606:      -dd _c_h_a_r   Use _c_h_a_r as field delimiter
        !           607:      -ff _l_i_s_t   _l_i_s_t specifies fields
        !           608:      -ss        Suppress lines without field delimiters
        !           609: #date
        !           610: ddaattee -- Print/set the date and time
        !           611: 
        !           612: ddaattee [-ss] [-uu] [[_y_y_m_m_d_d]_h_h_m_m[._s_s]]
        !           613: 
        !           614: _O_p_t_i_o_n_s:
        !           615:      -ss        Suppress daylight savings time conversion
        !           616:      -uu        Print (and enter) date in Greenwich Mean Time
        !           617: #db
        !           618: ddbb -- Assembler-level symbolic debugger
        !           619: 
        !           620: ddbb [-ccddeeffoorrtt] [_m_a_p_f_i_l_e] [_p_r_o_g_r_a_m]
        !           621: 
        !           622: _O_p_t_i_o_n_s:
        !           623:      -cc        Map _p_r_o_g_r_a_m as a core file
        !           624:      -dd        Map _p_r_o_g_r_a_m as a system dump; _m_a_p_f_i_l_e defaults to /ccoohheerreenntt
        !           625:      -ee        Next argument is object file and rest of command line is passed
        !           626:                to the child process
        !           627:      -ff        Map _p_r_o_g_r_a_m as binary data
        !           628:      -oo        _p_r_o_g_r_a_m is an object file
        !           629:      -rr        Access all files read-only
        !           630:      -tt        Perform input and output via /ddeevv/ttttyy rather than stdin and
        !           631:                stdout
        !           632: 
        !           633: By default, _p_r_o_g_r_a_m is assumed to be an object file.  _m_a_p_f_i_l_e defaults to ll.oouutt
        !           634: and _p_r_o_g_r_a_m defaults to ccoorree.
        !           635: #dc
        !           636: ddcc -- Desk calculator
        !           637: 
        !           638: ddcc [_f_i_l_e]
        !           639: 
        !           640: Arbitrary precision desk calculator with registers, using reverse-Polish
        !           641: notation.  Reads input from _f_i_l_e if given, then from stdin.
        !           642: #dcheck
        !           643: ddcchheecckk -- Check directory consistency
        !           644: 
        !           645: ddcchheecckk [-ss] [-ii _i_n_u_m_b_e_r...] _f_i_l_e_s_y_s_t_e_m ...
        !           646: 
        !           647: _O_p_t_i_o_n_s:
        !           648:      -ss        Cause ddcchheecckk to correct link counts automatically
        !           649:      -ii        Print information about each given i-number
        !           650: #dd
        !           651: dddd -- File conversion
        !           652: 
        !           653: dddd [_o_p_t_i_o_n=_v_a_l_u_e] ...
        !           654: 
        !           655: _O_p_t_i_o_n_s:
        !           656:      bbss=_n      Set I/O buffer size to _n
        !           657:      ccbbss=_n     Set conversion buffer size to _n
        !           658:      ccoonnvv=_l_i_s_t Comma-separated list of conversions:
        !           659:         aasscciiii  Convert EBCDIC to ASCII
        !           660:         eebbccddiicc Convert ASCII to standard EBCDIC
        !           661:         iibbmm    Convert ASCII to IBM print codes
        !           662:         llccaassee  Map all letters to lower case
        !           663:         nnooeerrrroorr
        !           664:                Continue if error occurs
        !           665:         sswwaabb   Swap byte pairs
        !           666:         ssyynncc   Pad input to _i_b_s
        !           667:         uuccaassee  Map all letters to upper case
        !           668:      ccoouunntt=_n   Number of buffers to copy from input
        !           669:      ffiilleess=_n   Number of files to copy (useful with tape)
        !           670:      iibbss=_n     Input buffer size
        !           671:      iiff=_f_i_l_e   Set input file to _f_i_l_e
        !           672:      oobbss=_n     Set output block size to _n
        !           673:      ooff=_f_i_l_e   Set output file to _f_i_l_e
        !           674:      sseeeekk=_n    Set seek position of output to _n
        !           675:      sskkiipp=_n    Skip _n input blocks
        !           676: #deroff
        !           677: ddeerrooffff -- Remove text formatting control information
        !           678: 
        !           679: ddeerrooffff [-ww] [-xx] [_f_i_l_e ...]
        !           680: 
        !           681: _O_p_t_i_o_n_s:
        !           682:      -ww        Divide the output into words, one per line
        !           683:      -xx        Extra knowledge of macro packages
        !           684: #detab
        !           685: ddeettaabb -- Replace tab characters with spaces
        !           686: 
        !           687: ddeettaabb [-tt_t_a_b_s_i_z_e]
        !           688: 
        !           689: _O_p_t_i_o_n:
        !           690:      -tt_t_a_b_s_i_z_e Set _t_a_b_s_i_z_e (2-256, inclusive)
        !           691: #df
        !           692: ddff -- Measure free space on disk
        !           693: 
        !           694: ddff [-aaiitt] _d_e_v_i_c_e
        !           695: 
        !           696: _O_p_t_i_o_n_s:
        !           697:      -aa        Give entries only for mounted devices
        !           698:      -ii        Summarize i-node usage
        !           699:      -tt        Give total number of blocks on _d_e_v_i_c_e
        !           700: #diff
        !           701: ddiiffff -- Summarize differences between two files
        !           702: 
        !           703: ddiiffff [-bbddeeffhh] [-cc _s_y_m_b_o_l] _f_i_l_e_1 _f_i_l_e_2
        !           704: 
        !           705: _O_p_t_i_o_n_s:
        !           706:      -bb        Ignore trailing blanks; all strings of blanks are equal
        !           707:      -cc _s_y_m    Make ccpppp input conditionalized on _s_y_m
        !           708:      -dd        Use -hh algorithm for large (>25,000 character) files
        !           709:      -ee        Make eedd script
        !           710:      -ff        Make fake (non-usable) eedd script
        !           711:      -hh        Half-hearted algorithm (works on long files)
        !           712:      -ss        Make sseedd script
        !           713: 
        !           714: If either _f_i_l_e_1 or _f_i_l_e_2 is `-', stdin is used.  If one _f_i_l_e is a directory,
        !           715: the other _f_i_l_e under that directory is used.
        !           716: #diff3
        !           717: ddiiffff33 -- Summarize differences among three files
        !           718: 
        !           719: ddiiffff33 [-eexx33] _f_i_l_e_1 _f_i_l_e_2 _f_i_l_e_3
        !           720: 
        !           721: _O_p_t_i_o_n_s:
        !           722:      -ee        Make eedd script to change _f_i_l_e_2 and _f_i_l_e to _f_i_l_e_1 (changes marked
        !           723:                with ==== or ====33)
        !           724:      -xx        Above script with changes marked ==== (all different)
        !           725:      -33        Above script with changes marked ====33 (_f_i_l_e_3 different)
        !           726: #dirs
        !           727: ddiirrss -- Print the contents of the directory stack
        !           728: 
        !           729: ddiirrss
        !           730: 
        !           731: sshh only.
        !           732: #disable
        !           733: ddiissaabbllee -- Disable a port
        !           734: 
        !           735: /eettcc/ddiissaabbllee _p_o_r_t...
        !           736: 
        !           737: #domain
        !           738: ddoommaaiinn -- Set your system's mail domain
        !           739: 
        !           740: /eettcc/ddoommaaiinn
        !           741: 
        !           742: #dos
        !           743: ddooss -- Manipulate files on MS-DOS file systems
        !           744: 
        !           745: ddooss [-]ddFFllrrttxx[_f_l_a_g_s] [_d_e_v_i_c_e] [_f_i_l_e ...]
        !           746: 
        !           747: _C_o_m_m_a_n_d_s:
        !           748:      dd         Delete specified files
        !           749:      FF         Build MS-DOS file system (format)
        !           750:      ll[_l_a_b_e_l]  Label disk
        !           751:      rr         Replace _f_i_l_e_s (default, all files in `.')
        !           752:      tt         List contents (default, all files)
        !           753:      xx         Extract specified _f_i_l_e_s (default, all files)
        !           754: _F_l_a_g_s:
        !           755:      aa         ASCII data extract/replace (default, binary data)
        !           756:      cc         Read only; do not write changes to MS-DOS file system
        !           757:      kk         Keep _m_t_i_m_e on extract/replace (default, now)
        !           758:      nn         Newest files first in list (default, alphabetized)
        !           759:      pp         Piped extract/replace
        !           760:      ss_d_i_r      Suppress subdirectory _d_i_r
        !           761:      vv         Verbose
        !           762:      [11-99]     Specify logical drive on extended MS-DOS partition
        !           763: 
        !           764: The default device is /ddeevv/ddooss.
        !           765: #doscat
        !           766: ddoossccaatt -- Concatenate a file on an MS-DOS file system
        !           767: 
        !           768: ddoossccaatt _d_e_v_i_c_e:[/_d_i_r_e_c_t_o_r_y/]_f_i_l_e
        !           769: 
        !           770: #doscp
        !           771: ddoossccpp -- Copy files to/from an MS-DOS file system
        !           772: 
        !           773: ddoossccpp [-aabbkkmmrrvv] _s_r_c _d_e_s_t
        !           774: 
        !           775: _O_p_t_i_o_n_s
        !           776:      aa         ASCII.  When copying from MS-DOS to COHERENT, convert the
        !           777:                carriage-return/newline combination to newline characters; when
        !           778:                copying from COHERENT to MS-DOS, do the opposite.
        !           779:      bb         Binary.  Do not convert newline conversion.
        !           780:      kk         Keep the time stamp on copied files.
        !           781:      mm         Move.  Same as aa, described above.
        !           782:      rr         Same as bb, described above.
        !           783:      vv         Verbose.  Describe each action as it is executed.
        !           784: #doscpdir
        !           785: ddoossccppddiirr -- Copy a directory to/from an MS-DOS file system
        !           786: 
        !           787: ddoossccppddiirr [-aakkmmvv] _s_r_c _d_e_s_t
        !           788: 
        !           789: _O_p_t_i_o_n_s
        !           790:      aa         ASCII.  When copying from MS-DOS to COHERENT, convert the
        !           791:                carriage-return/newline combination to newline characters; when
        !           792:                copying from COHERENT to MS-DOS, do the opposite.
        !           793:      kk         Keep the time stamp on copied files.
        !           794:      mm         Move.  Same as aa, described above.
        !           795:      vv         Verbose.  Describe each action as it is executed.
        !           796: #dosdel
        !           797: ddoossddeell -- Delete a file from an MS-DOS file system
        !           798: 
        !           799: ddoossddeell [-vv] _d_e_v_i_c_e:/_d_i_r/_f_i_l_e
        !           800: 
        !           801: _O_p_t_i_o_n
        !           802:      vv         Verbose.  Describe each action as it is executed.
        !           803: #dosdir
        !           804: ddoossddiirr -- List contents of an MS-DOS directory
        !           805: 
        !           806: ddoossddiirr [-nnvv] _d_e_v_i_c_e:[_d_i_r/][_f_i_l_e]
        !           807: 
        !           808: _O_p_t_i_o_n_s
        !           809:      nn         List files in order of creation (newest file last) rather than
        !           810:                in alphabetical order.
        !           811:      vv         Verbose.  Describe each action as it is executed.
        !           812: #dosformat
        !           813: ddoossffoorrmmaatt -- Format a floppy disk
        !           814: 
        !           815: ddoossffoorrmmaatt [-vv] _d_e_v_i_c_e
        !           816: 
        !           817: _O_p_t_i_o_n
        !           818:      vv         Verbose.  Describe each action as it is executed.
        !           819: #doslabel
        !           820: ddoossllaabbeell -- Label an MS-DOS floppy disk
        !           821: 
        !           822: ddoossllaabbeell [-vv] _d_e_v_i_c_e: _l_a_b_e_l
        !           823: 
        !           824: _O_p_t_i_o_n
        !           825:      vv         Verbose.  Describe each action as it is executed.
        !           826: #dosls
        !           827: ddoossllss -- List files on an MS-DOS file system
        !           828: 
        !           829: ddoossllss [-vv] _d_e_v_i_c_e:[/_d_i_r_e_c_t_o_r_y/][_f_i_l_e]
        !           830: 
        !           831: _O_p_t_i_o_n:
        !           832:      -vv        Print output in long format, analogous to llss -ll.
        !           833: #dosmkdir
        !           834: ddoossmmkkddiirr -- Create a directory in an MS-DOS file system
        !           835: 
        !           836: ddoossmmkkddiirr _d_e_v_i_c_e:_d_i_r_e_c_t_o_r_y
        !           837: 
        !           838: #dosrm
        !           839: ddoossrrmm -- Remove a file from an MS-DOS file system
        !           840: 
        !           841: ddoossrrmm _d_e_v_i_c_e:[/_d_i_r_e_c_t_o_r_y/]_f_i_l_e
        !           842: 
        !           843: #dosrmdir
        !           844: ddoossrrmmddiirr -- Remove a directory from an MS-DOS file system
        !           845: 
        !           846: ddoossrrmmddiirr _d_e_v_i_c_e:_d_i_r_e_c_t_o_r_y
        !           847: 
        !           848: #drvld
        !           849: ddrrvvlldd -- Load a loadable driver into memory
        !           850: 
        !           851: /eettcc/ddrrvvlldd _o_p_t_i_o_n_s _d_r_i_v_e_r
        !           852: 
        !           853: _O_p_t_i_o_n_s:
        !           854:      -kk _k_e_r_n_e_l Use the symbol table from _k_e_r_n_e_l instead of the default
        !           855:                /ccoohheerreenntt.
        !           856:      -rr        Remove any temporary files it creates in directory /ttmmpp.
        !           857:      -oo _o_u_t_f_i_l_e
        !           858:                Write debugginf symbol table to _o_u_t_f_i_l_e rather than to
        !           859:                /ttmmpp/_d_r_i_v_e_r.
        !           860: #drvld.all
        !           861: ddrrvvlldd.aallll -- Load loadable drivers at boot time
        !           862: 
        !           863: /eettcc/ddrrvvlldd.aallll
        !           864: 
        !           865: #du
        !           866: dduu -- Summarize disk usage
        !           867: 
        !           868: dduu [-aa] [-ss] [_d_i_r_e_c_t_o_r_y ...]
        !           869: 
        !           870: _O_p_t_i_o_n_s:
        !           871:      -aa        Print an entry for each file
        !           872:      -ss        Print only a summary
        !           873: #dump
        !           874: dduummpp -- File-system backup utility
        !           875: 
        !           876: dduummpp [_o_p_t_i_o_n_s] [_a_r_g_u_m_e_n_t ...]
        !           877: 
        !           878: _O_p_t_i_o_n_s:
        !           879:      00-99       Set dump level (default, 9)
        !           880:      bb         Next argument is blocking factor (default, 20)
        !           881:      dd         Next argument is density in bpi (default, 1600)
        !           882:      ff         Next argument is output device name
        !           883:      ss         Next argument is tape length in feet (default, 2300)
        !           884:      SS         Next argument is floppy disk size in blocks
        !           885:      uu         Update /eettcc/ddddaattee
        !           886:      vv         Verbose (display date and tape length)
        !           887: #dumpdate
        !           888: dduummppddaattee -- Print dump dates
        !           889: 
        !           890: dduummppddaattee [_f_i_l_e_s_y_s_t_e_m ...]
        !           891: 
        !           892: #dumpdir
        !           893: dduummppddiirr -- Print the directory of a dump
        !           894: 
        !           895: dduummppddiirr [aaff [_a_r_g_u_m_e_n_t ...] ]
        !           896: 
        !           897: _O_p_t_i_o_n_s:
        !           898:      aa         List normally suppressed `.' and `..' names
        !           899:      ff         Next argument is dump device name (default, /ddeevv/dduummpp)
        !           900: #echo
        !           901: eecchhoo -- Repeat/expand an argument
        !           902: 
        !           903: eecchhoo [-nn] [_a_r_g_u_m_e_n_t ...]
        !           904: 
        !           905: _O_p_t_i_o_n:
        !           906:      -nn        Do not print terminal newline
        !           907: 
        !           908: Copies all command arguments to the standard output, with the following
        !           909: special-character sequences being replaced with the equivalent ASCII character:
        !           910:      \bb        Backspace
        !           911:      \cc        Print line without a newline (like -nn option)
        !           912:      \ff        Formfeed
        !           913:      \nn        Newline
        !           914:      \rr        Carriage return
        !           915:      \tt        Tab
        !           916:      \vv        Vertical tab
        !           917:      \\        Backslash
        !           918:      \_n_n_n      _n_n_n is octal value of desired character
        !           919: #ed
        !           920: eedd -- Interactive line editor
        !           921: 
        !           922: eedd [-] [+ccmmooppssvv] [_f_i_l_e]
        !           923: 
        !           924: _O_p_t_i_o_n_s:
        !           925:      -         Suppress character counts on rr, ww, ee commands
        !           926:      -xx        Encrypt _f_i_l_e
        !           927:      +cc        Print character counts on rr, ww, ee
        !           928:      +mm        Allow multiple commands per line
        !           929:      +oo        Print line counts instead of character counts
        !           930:      +pp        Prompt for each command with `*'
        !           931:      +ss        Lower case matches upper in patterns
        !           932:      +vv        Verbose error messages
        !           933: #egrep
        !           934: eeggrreepp -- Extended pattern search
        !           935: 
        !           936: eeggrreepp [_o_p_t_i_o_n ...] [_p_a_t_t_e_r_n] [_f_i_l_e ...]
        !           937: 
        !           938: _O_p_t_i_o_n_s:
        !           939:      -AA        Build _e_r_r_o_r _l_i_s_t for interactive editing using MicroEMACS, like
        !           940:                -AA option to the cccc command
        !           941:      -bb        Each output line has block number of match
        !           942:      -cc        Print only a count of the matching lines
        !           943:      -ee        Next argument is _p_a_t_t_e_r_n
        !           944:      -ff        Next argument is file with one pattern per line
        !           945:      -hh        Suppress printing of file names on matched lines
        !           946:      -ll        Print only names of files containing matches
        !           947:      -nn        Print line number of file with each matched line output
        !           948:      -ss        Suppress output, just return status
        !           949:      -vv        Negate the sense of match
        !           950:      -yy        Lower-case letters in _p_a_t_t_e_r_n match upper- and lower-case
        !           951: 
        !           952: The _p_a_t_t_e_r_n is a pattern roughly like that found in eedd.  If no _f_i_l_e is
        !           953: specified, stdin is read.  eeggrreepp is like ggrreepp -aa, but is an order of magnitude
        !           954: faster.
        !           955: #elvis
        !           956: eellvviiss -- Clone of Berkeley-standard screen editor
        !           957: 
        !           958: eellvviiss [ _o_p_t_i_o_n_s ] [ +_c_m_d ] [ _f_i_l_e_1 ... _f_i_l_e_2_7 ]
        !           959: 
        !           960: _O_p_t_i_o_n_s:
        !           961:      -ee        Begin in colon-command mode
        !           962:      -ii        Begin in input mode
        !           963:      -rr        Recover a previous edit
        !           964:      -RR        Read-only mode
        !           965:      -tt _t_a_g    Begin editing at _t_a_g
        !           966:      -mm        Use in error-handling mode
        !           967:      -vv        Begin in visual-command mode
        !           968:      +_c_o_m_m_a_n_d  Execute _c_o_m_m_a_n_d before editing
        !           969: #enable
        !           970: eennaabbllee -- Enable a port
        !           971: 
        !           972: /eettcc/eennaabbllee _p_o_r_t...
        !           973: 
        !           974: #env
        !           975: eennvv -- Execute a command in an environment
        !           976: 
        !           977: eennvv [-] [_V_A_R_I_A_B_L_E=_v_a_l_u_e ...] [_c_o_m_m_a_n_d _a_r_g_s]
        !           978: 
        !           979: #epson
        !           980: eeppssoonn -- Print files on Epson printer
        !           981: 
        !           982: eeppssoonn [ -ccddffrrww88 ] [ -bb _h_e_a_d ] [ -ii _n ] [ -oo _o_f_i_l_e ] [ -ss _n ] [ _f_i_l_e ... ]
        !           983: 
        !           984: _O_p_t_i_o_n_s:
        !           985:      bb _h_e_a_d    Print wide banner _h_e_a_d at top of first page
        !           986:      cc         Compressed printing
        !           987:      dd         Print boldface with double strike, not emphasize mode
        !           988:      ff         Suppress formfeed after each _f_i_l_e
        !           989:      ii_n        Indent output 'n' spaces
        !           990:      oo _o_f_i_l_e   Send output to _o_f_i_l_e (default, /ddeevv/llpp)
        !           991:      rr         Use only Roman character set (no italics)
        !           992:      ss_n        Vertical spacing _n (default, 1)
        !           993:      ww         Double-width printing
        !           994:      88         Eight lines per inch (default, six)
        !           995: #eval
        !           996: eevvaall -- Evaluate arguments
        !           997: 
        !           998: eevvaall [_t_o_k_e_n ...]
        !           999: 
        !          1000: The shell executes eevvaall directly.
        !          1001: #ex
        !          1002: eexx -- Berkeley-style line editor
        !          1003: 
        !          1004: eexx [ _o_p_t_i_o_n_s ] [ +_c_m_d ] [ _f_i_l_e_1 ... _f_i_l_e_2_7 ]
        !          1005: 
        !          1006: _O_p_t_i_o_n_s:
        !          1007:      -rr        Recover a previous edit
        !          1008:      -RR        Read-only mode
        !          1009:      -tt _t_a_g    Begin editing at _t_a_g
        !          1010:      -mm        Use in error-handling mode
        !          1011:      +_c_o_m_m_a_n_d  Execute _c_o_m_m_a_n_d before editing
        !          1012: #exec
        !          1013: eexxeecc -- Execute command directly
        !          1014: 
        !          1015: eexxeecc [_c_o_m_m_a_n_d]
        !          1016: 
        !          1017: The shell executes _c_o_m_m_a_n_d by eexxeecc rather than ffoorrkk.  This normally terminates
        !          1018: the current shell.  Current shell I/O may be redirected by eexxeecc with no
        !          1019: _c_o_m_m_a_n_d.
        !          1020: #exit
        !          1021: eexxiitt -- Exit from a shell
        !          1022: 
        !          1023: eexxiitt [_s_t_a_t_u_s]
        !          1024: 
        !          1025: The previous status is retained if none is specified.  eexxiitt sets the status but
        !          1026: does not terminate an interactive shell.  The shell executes eexxiitt directly.
        !          1027: #export
        !          1028: eexxppoorrtt -- Add a shell variable to the environment
        !          1029: 
        !          1030: eexxppoorrtt [_n_a_m_e ...]
        !          1031: eexxppoorrtt [_n_a_m_e=_v_a_l_u_e]
        !          1032: 
        !          1033: #expr
        !          1034: eexxpprr -- Compute a command-line expression
        !          1035: 
        !          1036: eexxpprr _a_r_g_u_m_e_n_t ...
        !          1037: 
        !          1038: _O_p_t_i_o_n_s:
        !          1039:      nn         Any integer with optional sign
        !          1040:      _s_t_r_i_n_g    Used with comparisons and lleenn operator
        !          1041:      +         Arithmetic operators (one of `+', `-', `*', `/', `%')
        !          1042:      !         Unary not
        !          1043:      -         Unary minus
        !          1044:      ==        Relational operators (one of `>', `<', `>=', `<=', `==', `!=')
        !          1045:      &         Logical AND of previous and next expression
        !          1046:      |         Logical OR of previous and next expression
        !          1047:      lleenn       Length of string given by next argument
        !          1048:      _e_1:_e_2     Set to number of characters matching regular expression _e_2 in
        !          1049:                string _e_1; if _e_2 contains any `\(...\)' sequences, result is
        !          1050:                concatenation of matched parts
        !          1051:      ( _e )     Parentheses for grouping
        !          1052:      {
        !          1053:                EEvvaalluuaattee _e_2 if _e_1 is true, _e_3 otherwise; _e_3 defaults to 0 if
        !          1054:                missing
        !          1055: #factor
        !          1056: ffaaccttoorr -- Factor a number
        !          1057: 
        !          1058: ffaaccttoorr [ _n_u_m_b_e_r ... ]
        !          1059: 
        !          1060: #false
        !          1061: ffaallssee -- Unconditional failure
        !          1062: 
        !          1063: ffaallssee
        !          1064: 
        !          1065: #fc
        !          1066: ffcc -- Edit and re-execute one or more previous commands
        !          1067: 
        !          1068: ffcc [-llnn] [_f_i_r_s_t [_l_a_s_t]]
        !          1069: ffcc -ss [_o_l_d=_n_e_w] [_c_o_m_m_a_n_d]"
        !          1070: 
        !          1071: _O_p_t_i_o_n_s:
        !          1072:      -ll        Print commands on stdout
        !          1073:      -nn        Suppress default command numbers
        !          1074: 
        !          1075: kksshh only.
        !          1076: #fdformat
        !          1077: ffddffoorrmmaatt -- Low-level format a floppy disk
        !          1078: 
        !          1079: /eettcc/ffddffoorrmmaatt [ _o_p_t_i_o_n ... ] _s_p_e_c_i_a_l
        !          1080: 
        !          1081: _O_p_t_i_o_n_s:
        !          1082:      -aa        Print information on stdout during format
        !          1083:      -ii _n      Interleave factor _n (0-7; default, 6)
        !          1084:      -oo _n      Skew factor _n for sector numbering (default, 0)
        !          1085:      -vv        Verify
        !          1086:      -ww _f_i_l_e   Copy _f_i_l_e to formatted floppy disk track by track
        !          1087: #fdisk
        !          1088: ffddiisskk -- Hard-disk partitioning utility
        !          1089: 
        !          1090: /eettcc/ffddiisskk [-rr] [-cc] [-bb _m_b_o_o_t] _x_d_e_v ...
        !          1091: 
        !          1092: _O_p_t_i_o_n_s:
        !          1093:      -rr        Read-only access
        !          1094:      -bb        Add master boot code from file _m_b_o_o_t
        !          1095:      -cc        Specify disk geometry for non-standard drives
        !          1096: 
        !          1097: A hard disk can be split into a maximum of four partitions (logical devices).
        !          1098: #file
        !          1099: ffiillee -- Guess a file's type
        !          1100: 
        !          1101: ffiillee _f_i_l_e ...
        !          1102: 
        !          1103: #find
        !          1104: ffiinndd -- Search for files satisfying a pattern
        !          1105: 
        !          1106: ffiinndd _d_i_r_e_c_t_o_r_y ... [_e_x_p_r_e_s_s_i_o_n ...]
        !          1107: 
        !          1108: _E_x_p_r_e_s_s_i_o_n:
        !          1109:      -aattiimmee _n  File has been accessed in _n days
        !          1110:      -ccttiimmee _n  File's i-node has been changed in _n days
        !          1111:      -eexxeecc _c_m_d Command _c_m_d is successful
        !          1112:      -ggrroouupp _g_n File belongs to group _g_n
        !          1113:      -iinnuumm _n   File has i-node _n
        !          1114:      -lliinnkkss _n  File has _n links to it
        !          1115:      -mmttiimmee _n  File has been modified within _n days
        !          1116:      -nnaammee _p_a_t_t_e_r_n
        !          1117:                File name matches _p_a_t_t_e_r_n (shell conventions)
        !          1118:      -nneewweerr_f_i_l_e
        !          1119:                File has been modified since _f_i_l_e
        !          1120:      -nnoopp      Always true; does nothing
        !          1121:      -ookk _c_m_d   Like -eexxeecc, except it asks
        !          1122:      -ppeerrmm _o_c_t_a_l
        !          1123:                File permissions are _o_c_t_a_l
        !          1124:      -pprriinntt    Always true; prints current path name
        !          1125:      -ssiizzee _n   File is _n blocks long
        !          1126:      -ttyyppee _c   File matches type (_c may be [bcdfmp])
        !          1127:      -uusseerr _u_n_a_m_e
        !          1128:                _u_n_a_m_e owns file
        !          1129:      eexxpp -aa _e_x_p _e_x_p
        !          1130:                Both expressions are true
        !          1131:      eexxpp -oo _e_x_p _e_x_p
        !          1132:                One of the expressions is true
        !          1133:      ! _e_x_p     Expression is false
        !          1134:      (_e_x_p)     Parentheses for grouping
        !          1135: 
        !          1136: If no expression is specified, -pprriinntt is assumed.
        !          1137: #fixstack
        !          1138: ffiixxssttaacckk -- Change stack allocation
        !          1139: 
        !          1140: ffiixxssttaacckk +-_v_a_l_u_e [ _f_i_l_e_n_a_m_e ]
        !          1141: 
        !          1142: This command applies to COHERENT 286 only
        !          1143: #fnkey
        !          1144: ffnnkkeeyy -- Set/print function keys for the console
        !          1145: 
        !          1146: ffnnkkeeyy [ _n [ _s_t_r_i_n_g ] ]
        !          1147: 
        !          1148: Sets function key _n to send _s_t_r_i_n_g; if no _s_t_r_i_n_g, set it to send nothing.  If
        !          1149: no arguments, ffnnkkeeyy prints the function keys.
        !          1150: #for
        !          1151: ffoorr -- Execute commands for tokens in list
        !          1152: 
        !          1153: ffoorr _n_a_m_e [iinn _t_o_k_e_n ...] ddoo _s_e_q_u_e_n_c_e ddoonnee
        !          1154: 
        !          1155: If _i_n clause is omitted, list of positional parameters to current script is
        !          1156: assumed.  Both ddoo and ddoonnee must be first token on line or preceded by `;'.  The
        !          1157: shell executes ffoorr directly.
        !          1158: #fortune
        !          1159: ffoorrttuunnee -- Print randomly selected, hopefully humorous, text
        !          1160: 
        !          1161: /uussrr/ggaammeess/ffoorrttuunnee [ _f_i_l_e ]
        !          1162: 
        !          1163: _O_p_t_i_o_n:
        !          1164:      _f_i_l_e      Read a fortune from _f_i_l_e, instead of the default file
        !          1165:                /uussrr/ggaammeess/lliibb/ffoorrttuunneess
        !          1166: #from
        !          1167: ffrroomm -- Generate list of numbers, for use in loop
        !          1168: 
        !          1169: ffrroomm _s_t_a_r_t ttoo _s_t_o_p [ bbyy _i_n_c_r ]
        !          1170: 
        !          1171: _s_t_a_r_t, _s_t_o_p, and _i_n_c_r (default, one) are decimal integers with optional `-'.
        !          1172: #fsck
        !          1173: ffsscckk -- Check and repair file systems interactively
        !          1174: 
        !          1175: /eettcc/ffsscckk [ -ffnnqqssSSyy ] [ -tt _t_e_m_p_f_i_l_e ] [ _f_i_l_e_s_y_s_t_e_m ... ]
        !          1176: 
        !          1177: _O_p_t_i_o_n_s:
        !          1178:      -ff        Fast check; check only if a block is claimed by more than one i-
        !          1179:                node, by an i-node and the free list, or more than once in the
        !          1180:                free list
        !          1181:      -nn        Default reply of no to all queries
        !          1182:      -qq        Quiet option; syppress file name warning messages
        !          1183:      -ss        Force reconstruction of the free list for all unmounted file
        !          1184:                systems.
        !          1185:      -SS        Same as -ss, but works on mounted file systems as well.  Not for
        !          1186:                the faint of heart.
        !          1187:      -tt        Use _t_e_m_p_f_i_l_e instead of /ddeevv/rrrraamm11 for temporary storage
        !          1188:      -yy        Default reply of yes to all queries
        !          1189: #fwtable
        !          1190: ffwwttaabbllee -- Build font-width table
        !          1191: 
        !          1192: ffwwttaabbllee [ -ppvv ] [ _i_n_f_i_l_e [ _o_u_t_f_i_l_e ] ]
        !          1193: 
        !          1194: _O_p_t_i_o_n_s:
        !          1195:      -pp        Input is PostScript AFM file, not PCL bitmap font
        !          1196:      -vv        Write a brief font description to stderr
        !          1197: #getopts
        !          1198: ggeettooppttss -- Parse command-line options
        !          1199: 
        !          1200: ggeettooppttss _o_p_t_s_t_r_i_n_g _n_a_m_e [ _o_p_t ]
        !          1201: 
        !          1202: kksshh only.
        !          1203: #getty
        !          1204: ggeettttyy -- Terminal initialization
        !          1205: 
        !          1206: /eettcc/ggeettttyy _t_y_p_e
        !          1207: 
        !          1208: #grep
        !          1209: ggrreepp -- Pattern search
        !          1210: 
        !          1211: ggrreepp [ooppttiioonn ...] [_p_a_t_t_e_r_n] [_f_i_l_e ...]
        !          1212: 
        !          1213: _O_p_t_i_o_n_s:
        !          1214:      -aa        Extra metacharacters supported (`(...)', `|', `+', and `?')
        !          1215:      -bb        Each output line has block number of match
        !          1216:      -cc        Print only count of matching lines
        !          1217:      -ee        Next argument is pattern
        !          1218:      -ff        Next argument is file containing one pattern per line
        !          1219:      -hh        Suppress printing of file names on matched lines
        !          1220:      -ll        Print only names of files containing matches
        !          1221:      -nn        Print line number of file with each matched line output
        !          1222:      -ss        Suppress output, just return status
        !          1223:      -vv        Negate sense of match
        !          1224:      -xx        Exact match (don't expand metacharacters)
        !          1225:      -yy        Lower-case letters in _p_a_t_t_e_r_n match upper- and lower-case
        !          1226: 
        !          1227: The _p_a_t_t_e_r_n is a regular expression roughly like that found in eedd.  If no _f_i_l_e
        !          1228: is specified, stdin is read.
        !          1229: #guess
        !          1230: gguueessss -- Extraordinarily amusing guessing game
        !          1231: 
        !          1232: /uussrr/ggaammeess/gguueessss
        !          1233: 
        !          1234: #hash
        !          1235: hhaasshh -- Add a command to the shell's hash table
        !          1236: 
        !          1237: hhaasshh [-rr] [_c_o_m_m_a_n_d ... ]
        !          1238: 
        !          1239: _O_p_t_i_o_n:
        !          1240:      -rr        Remove _c_o_m_m_a_n_d from hash table
        !          1241: 
        !          1242: kksshh only.
        !          1243: #head
        !          1244: hheeaadd -- Print the beginning of a file
        !          1245: 
        !          1246: hheeaadd [+_n[bbccll]] [_f_i_l_e]
        !          1247: hheeaadd [-_n[bbccll]] [_f_i_l_e]
        !          1248: 
        !          1249: _O_p_t_i_o_n_s:
        !          1250:      +         Count from beginning of file
        !          1251:      -         Count from end of file
        !          1252:      bb         Count in blocks
        !          1253:      cc         Count in characters
        !          1254:      ll         Count in lines
        !          1255: #help
        !          1256: hheellpp -- Print concise description of command
        !          1257: 
        !          1258: hheellpp [-dd_c] [-ff_f_i_l_e] [-ii_f_i_l_e] [-rr] [_c_o_m_m_a_n_d]...
        !          1259: 
        !          1260: _O_p_t_i_o_n_s
        !          1261:      -dd_c       Use character _c as the delimiter between helpfile entries.
        !          1262:      -ff_f_i_l_e    Read _f_i_l_e as the helpfile, instead of the default /eettcc/hheellppffiillee.
        !          1263:      -ii_f_i_l_e    Read _f_i_l_e as the helpfile's index, instead of the default
        !          1264:                /eettcc/hheellppiinnddeexx.
        !          1265:      -rr        Rebuild the helpfile's index.
        !          1266: 
        !          1267: If _c_o_m_m_a_n_d is omitted, print information about $LLAASSTTEERRRROORR.
        !          1268: #hp
        !          1269: hhpp -- Prepare files for Hewlett-Packard LaserJet printer
        !          1270: 
        !          1271: hhpp [ -aaccffllrr ] [ -ii_m_a_r_g ] [ -tt_t_o_p ] [ -pp_l_i_n_e_s ] [ _f_i_l_e ... ]
        !          1272: 
        !          1273: _O_p_t_i_o_n_s:
        !          1274:      -aa        Substitute ` ' for '
        !          1275:      -cc        Toggle cartridge in place switch
        !          1276:      -ff        Print pages in forward order (default)
        !          1277:      -ll        Landscape mode
        !          1278:      -ii_m_a_r_g    Indent to _m_a_r_g
        !          1279:      -pp_l_i_n_e_s   Page length is _l_i_n_e_s
        !          1280:      -rr        Print pages in reverse order (for LaserJet I).
        !          1281:      -tt_m_a_r_g    Set top margin to _m_a_r_g
        !          1282: #hpd
        !          1283: hhppdd -- Hewlett-Packard LaserJet printer spooler daemon
        !          1284: 
        !          1285: /uussrr/lliibb/hhppdd
        !          1286: 
        !          1287: #hpr
        !          1288: hhpprr -- Send file to Hewlett-Packard LaserJet printer spooler
        !          1289: 
        !          1290: hhpprr [-BBcceemmnnrr] [-bb _b_a_n_n_e_r] [ -ff _f_o_n_t_n_u_m] [_f_i_l_e ...]
        !          1291: 
        !          1292: _O_p_t_i_o_n_s:
        !          1293:      -BB        Suppress banner page and extra page at termination.  _M_u_s_t be
        !          1294:                used with a PostScript printer.
        !          1295:      -bb        Next argument is the banner
        !          1296:      -cc        Make a copy of each _f_i_l_e in spool area
        !          1297:      -ee        Erase all fonts from printer's memory
        !          1298:      -ff _f_o_n_t_n_u_m _f_i_l_e_1 ... _f_i_l_e_N
        !          1299:                Load into printer memory the HP soft fonts in _f_i_l_e_1 through
        !          1300:                _f_i_l_e_N; set font identifiers beginning with _f_o_n_t_n_u_m
        !          1301:      -mm        Send a message when listing is complete
        !          1302:      -nn        No message (default)
        !          1303:      -rr        Remove files when they have been spooled
        !          1304: #hpskip
        !          1305: hhppsskkiipp -- Abort/restart current listing on Hewlett-Packard LaserJet
        !          1306: 
        !          1307: hhppsskkiipp [-rr]
        !          1308: 
        !          1309: _O_p_t_i_o_n:
        !          1310:      -rr        Restarts the current listing
        !          1311: #icheck
        !          1312: iicchheecckk -- i-node consistency check
        !          1313: 
        !          1314: iicchheecckk [-ss] [-bb _N ...] [ -vv ] _f_i_l_e_s_y_s_t_e_m ...
        !          1315: 
        !          1316: _O_p_t_i_o_n_s:
        !          1317:      -bb        The following numeric arguments give block numbers; all
        !          1318:                references to these blocks are printed, with type
        !          1319:      -ss        Repair file system (requires write access)
        !          1320:      -vv        Print summary of information about file system
        !          1321: #if
        !          1322: iiff -- Execute a command conditionally
        !          1323: 
        !          1324: iiff _s_e_q_u_e_n_c_e_1 tthheenn _s_e_q_u_e_n_c_e_2 [eelliiff _s_e_q_u_e_n_c_e_3 tthheenn _s_e_q_u_e_n_c_e_4] ... [eellssee _s_e_q_u_e_n_c_e_5] ffii
        !          1325: 
        !          1326: Each tthheenn, eelliiff, eellssee, and ffii must occur unquoted at the start of a line or
        !          1327: preceded by `;'.  The shell executes iiff directly.
        !          1328: #infocmp
        !          1329: iinnffooccmmpp -- De-compile a terminfo file
        !          1330: 
        !          1331: iinnffooccmmpp [_f_i_l_e ... ]
        !          1332: 
        !          1333: #init
        !          1334: iinniitt -- System initialization
        !          1335: 
        !          1336: /eettcc/iinniitt
        !          1337: 
        !          1338: init -- System initialization Usage:    /etc/init
        !          1339: #install
        !          1340: iinnssttaallll -- Install a software update onto COHERENT
        !          1341: 
        !          1342: /eettcc/iinnssttaallll _i_d _d_e_v_i_c_e _n_d_i_s_k_s
        !          1343: 
        !          1344: _A_r_g_u_m_e_n_t_s:
        !          1345:      _i_d        String that identifies the release; e.g., ccoohh.330011 identifies
        !          1346:                COHERENT release version 3.0.1.
        !          1347:      _d_e_v_i_c_e    The physical device from which the installation takes place;
        !          1348:                e.g., /ddeevv/ffhhaa00 identifies floppy-disk drive 0 (drive A), where
        !          1349:                it is a high-density, 5.25-inch disk.
        !          1350:      _n_d_i_s_k_s    Number of floppy disks in the release.
        !          1351: #jobs
        !          1352: jjoobbss -- Print information about jobs
        !          1353: 
        !          1354: jjoobbss
        !          1355: 
        !          1356: kksshh only.
        !          1357: #join
        !          1358: jjooiinn -- Join two data bases
        !          1359: 
        !          1360: jjooiinn [-aa [_n] ] [-ee _s_t_r_i_n_g ] [-jj[_n] _k_e_y_f] [-oo _n._m ...] [-tt_c] _f_i_l_e_1 _f_i_l_e_2
        !          1361: 
        !          1362: _O_p_t_i_o_n_s:
        !          1363:      -aa[_n]     Print unpaired records from file _n
        !          1364:      -ee _s      Replace empty fields on output with string _s
        !          1365:      -jj[_n] _k_e_y Use _k_e_y of file _n for comparison
        !          1366:      -oo [_n.]_m ..
        !          1367:                Subsequent arguments list fields to output; each has file _n and
        !          1368:                field number _m
        !          1369:      -tt_c       Field separator is character _c
        !          1370: 
        !          1371: If either _f_i_l_e_1 or _f_i_l_e_2 is `-', stdin is used.  The optional file _n may be
        !          1372: either 1 or 2; if omitted, both 1 and 2 are assumed.
        !          1373: #kermit
        !          1374: kkeerrmmiitt -- Inter-system communication and file transfer
        !          1375: 
        !          1376: kkeerrmmiitt cc[bbeellLL _b_a_u_d _e_s_c _l_i_n_e]
        !          1377: kkeerrmmiitt rr[bbddffhhiillLLtt _b_a_u_d _l_i_n_e]
        !          1378: kkeerrmmiitt ss[aabbddffhhiillLLmmttxx _b_a_u_d _l_i_n_e] _f_i_l_e ...
        !          1379: 
        !          1380: _M_o_d_e_s:
        !          1381:      cc         Connect
        !          1382:      rr         Receive
        !          1383:      ss         Send
        !          1384: _O_p_t_i_o_n_s:
        !          1385:      aa         Specify path for sending and receiving files
        !          1386:      bb _b_a_u_d    Use given baud rate
        !          1387:      dd         Print debug information
        !          1388:      ee _e_s_c     Use _e_s_c as escape character (default, `^')
        !          1389:      ff         Suppress file-name conversion
        !          1390:      hh         Host mode
        !          1391:      ii         Image mode (for non-ASCII transfer)
        !          1392:      ll _l_i_n_e    Use given line
        !          1393:      LL         Log all commands into file LLoogg
        !          1394:      mm         Macintosh mode
        !          1395:      tt         Tymnet mode
        !          1396:      xx         Use complete path name for receiving file
        !          1397: _C_o_m_m_a_n_d_s:
        !          1398:      _e_s_ccc      Exit from kkeerrmmiitt
        !          1399:      _e_s_css      Suspend kkeerrmmiitt
        !          1400: #kill
        !          1401: kkiillll -- Signal a process
        !          1402: 
        !          1403: kkiillll [- _s_i_g_n_a_l ] _p_i_d ...
        !          1404: 
        !          1405: #ksh
        !          1406: kksshh -- The Korn shell
        !          1407: 
        !          1408: kksshh _t_o_k_e_n ...
        !          1409: 
        !          1410: #l
        !          1411: ll -- List directory's contents in long format
        !          1412: 
        !          1413: ll [_f_i_l_e ...]
        !          1414: 
        !          1415: #lc
        !          1416: llcc -- List directory's contents in columnar format
        !          1417: 
        !          1418: llcc [ -11aabbccddffpp ] [ _d_i_r_e_c_t_o_r_y ...]
        !          1419: 
        !          1420: _O_p_t_i_o_n_s:
        !          1421:      -11        List files one per line instead of in columns
        !          1422:      -aa        List all files in directory (including `.' and `..')
        !          1423:      -bb        List block-special files only
        !          1424:      -cc        List character-special files only
        !          1425:      -dd        List directories only
        !          1426:      -ff        List regular files only
        !          1427:      -pp        List pipe files only
        !          1428: 
        !          1429: Options can be combined.  If no _d_i_r_e_c_t_o_r_y is specified, the current directory
        !          1430: is used.
        !          1431: #ld
        !          1432: lldd -- Link relocatable object modules
        !          1433: 
        !          1434: lldd [_o_p_t_i_o_n ...] _f_i_l_e ...
        !          1435: 
        !          1436: _O_p_t_i_o_n_s:
        !          1437:      -dd        Define commons (even if undefined symbols).  COHERENT 286 only.
        !          1438:      -ee _e_n_t    Set entry point to symbol or octal number
        !          1439:      -ff        (Force) Force link even if there are errors
        !          1440:      -ii        Bind output sepid
        !          1441:      -KK        Rebuilt a new kernel.
        !          1442:      -LL_d_i_r_e_c_t_o_r_y
        !          1443:                Search _d_i_r_e_c_t_o_r_y for libraries and objects before searching the
        !          1444:                directories named in the environmental variable LLIIBBPPAATTHH
        !          1445:      -ll_l_i_b     Use standard library _l_i_b
        !          1446:      -oo _f_i_l_e   Write output into _f_i_l_e (default, _l._o_u_t)
        !          1447:      -qq        (Quiet) Suppress all warning messages
        !          1448:      -QQ        Quiet: Suppress all error messages
        !          1449:      -rr        Retain relocation information
        !          1450:      -ss        Discard symbol table
        !          1451:      -uu _s_y_m    Undefine _s_y_m (force library search)
        !          1452:      -xx        Discard all local symbols
        !          1453:      -XX        Discard C internal local symbols
        !          1454: #let
        !          1455: lleett -- Evaluate an expression
        !          1456: 
        !          1457: lleett [_e_x_p_r_e_s_s_i_o_n]
        !          1458: 
        !          1459: kksshh only.
        !          1460: #lex
        !          1461: lleexx -- Lexical analyzer generator
        !          1462: 
        !          1463: lleexx [-tt][-vv][_f_i_l_e]
        !          1464: cccc lleexx.yyyy.cc -llll
        !          1465: 
        !          1466: _O_p_t_i_o_n_s:
        !          1467:      -tt        Write to standard output instead of lleexx.yyyy.cc
        !          1468:      -vv        Give statistics about generated tables
        !          1469: #lf
        !          1470: llff -- List directory's contents in columnar format
        !          1471: 
        !          1472: llff [_f_i_l_e ...]
        !          1473: 
        !          1474: #lines
        !          1475: lliinneess -- Highly amusing board game
        !          1476: 
        !          1477: /uussrr/ggaammeess/lliinneess
        !          1478: 
        !          1479: #ln
        !          1480: llnn -- Create a link to a file
        !          1481: 
        !          1482: llnn [-ff] _o_l_d_f_i_l_e _n_e_w_f_i_l_e
        !          1483: llnn [-ff] _o_l_d_f_i_l_e ... _d_i_r_e_c_t_o_r_y
        !          1484: 
        !          1485: _O_p_t_i_o_n:
        !          1486:      -ff        Force link even if _n_e_w_f_i_l_e exists
        !          1487: #login
        !          1488: llooggiinn -- Log in or change user name
        !          1489: 
        !          1490: llooggiinn [_u_s_e_r_n_a_m_e]
        !          1491: 
        !          1492: #logmsg
        !          1493: llooggmmssgg -- Hold COHERENT Login Message
        !          1494: 
        !          1495: /eettcc/llooggmmssgg
        !          1496: 
        !          1497: #look
        !          1498: llooookk -- Find matching lines in a sorted file
        !          1499: 
        !          1500: llooookk [-ddff] _s_t_r_i_n_g [_f_i_l_e]
        !          1501: 
        !          1502: _O_p_t_i_o_n_s:
        !          1503:      -dd        Dictionary ordering
        !          1504:      -ff        Fold cases for comparison
        !          1505: 
        !          1506: If no _f_i_l_e, llooookk uses /uussrr/ddiicctt/wwoorrddss with -ddff option.
        !          1507: #lpd
        !          1508: llppdd -- Line printer spooler daemon
        !          1509: 
        !          1510: /uussrr/lliibb/llppdd
        !          1511: 
        !          1512: #lpr
        !          1513: llpprr -- Send to line printer spooler
        !          1514: 
        !          1515: llpprr [-ccmmnnrr] [-bb _b_a_n_n_e_r] [_f_i_l_e ...]
        !          1516: 
        !          1517: _O_p_t_i_o_n_s:
        !          1518:      -BB        Suppress printing of a banner.  This option mmuusstt be used with
        !          1519:                PostScript printers.
        !          1520:      -bb        Next argument is the banner
        !          1521:      -cc        Copy each _f_i_l_e in spool area
        !          1522:      -mm        Send a message when listing is complete
        !          1523:      -nn        No message (default)
        !          1524:      -rr        Remove files when they have been spooled
        !          1525: #lpskip
        !          1526: llppsskkiipp -- Terminate/restart current line printer listing
        !          1527: 
        !          1528: llppsskkiipp [-rr]
        !          1529: 
        !          1530: _O_p_t_i_o_n:
        !          1531:      -rr        Restart current listing
        !          1532: 
        !          1533: With no argument, terminate current listing.
        !          1534: #lr
        !          1535: llrr -- List subdirectories' contents in columnar format
        !          1536: 
        !          1537: llrr [_f_i_l_e ...]
        !          1538: 
        !          1539: #ls
        !          1540: llss -- List directory's contents
        !          1541: 
        !          1542: llss [-aabbCCccddFFffggiillmmnnooppqqRRrrssttuuxx] [_f_i_l_e ... ]
        !          1543: 
        !          1544: _O_p_t_i_o_n_s:
        !          1545:      -aa        List all files (including `.' and `..')
        !          1546:      -bb        Print non-graphic characters in octal
        !          1547:      -CC        Print output in multi-column format, sorted down the columns
        !          1548:      -cc        Use attribute change instead of modified time for -ll and -tt
        !          1549:      -dd        Treat directories like files
        !          1550:      -FF        Print `/' after directories and `*' after executables
        !          1551:      -ff        Treat _f_i_l_e as a directory even if it is not
        !          1552:      -ii        Print the i-number as well
        !          1553:      -ll        Long format: show file type, permissions, size
        !          1554:      -mm        Output file names separated by commas
        !          1555:      -nn        Same as -ll
        !          1556:      -pp        Print `/' after directory names
        !          1557:      -qq        Print non-graphic characters as `?'
        !          1558:      -RR        Recursively display directories
        !          1559:      -rr        Reverse the order of all sorting
        !          1560:      -ss        Print the file size in blocks as well
        !          1561:      -tt        Sort by times, newest first
        !          1562:      -uu        Use accessed rather than modified time
        !          1563:      -xx        Print multicolumn output, sorted across the columns
        !          1564: #lx
        !          1565: llxx -- List directory's contents in columnar format
        !          1566: 
        !          1567: llxx [_f_i_l_e ...]
        !          1568: 
        !          1569: #m4
        !          1570: mm44 -- Macro processor
        !          1571: 
        !          1572: mm44 [ffiillee ...]
        !          1573: 
        !          1574: If _f_i_l_e is `-' or omitted, mm44 reads the standard input.
        !          1575: #mail
        !          1576: mmaaiill -- Computer mail
        !          1577: 
        !          1578: mmaaiill [-mmppqqrrvv] [-ff _f_i_l_e] [_u_s_e_r ...]
        !          1579: 
        !          1580: _O_p_t_i_o_n_s:
        !          1581:      -ff _f_i_l_e   Print mail from _f_i_l_e instead of default
        !          1582:      -mm        Notify each logged-in recipient when mail is sent
        !          1583:      -pp        Print mail non-interactively
        !          1584:      -qq        Exit on interrupt, leaving mail unchanged
        !          1585:      -rr        Print mail in reverse order
        !          1586:      -vv        Verbose mode: show version and expanded aliases
        !          1587: 
        !          1588: If _u_s_e_r is present, send each a mail message read from standard input.  Mail
        !          1589: message ends with EOF, a line containing only `.', or a line containing only
        !          1590: `?'; the last moves the message into editor for further editing processing
        !          1591: before transmission.
        !          1592: _C_o_m_m_a_n_d_s:
        !          1593:      dd         Delete current message; print the next
        !          1594:      mm [_u_s_e_r ...]
        !          1595:                Mail current message to each _u_s_e_r
        !          1596:      pp         Print this message again
        !          1597:      qq         Quit and update mailbox
        !          1598:      rr         Reverse direction of scan through mailbox
        !          1599:      ss [_f_i_l_e ...]
        !          1600:                Save current message with header in each _f_i_l_e
        !          1601:      tt [_u_s_e_r ...]
        !          1602:                Send message from stdin to each _u_s_e_r
        !          1603:      ww  [_f_i_l_e ...]
        !          1604:                Write current message without header in each _f_i_l_e
        !          1605:      xx         Exit without updating mailbox
        !          1606:      <nneewwlliinnee> Print the next message
        !          1607:      -         Print the previous message
        !          1608:      EOF       Quit and update mailbox; same as qq command
        !          1609:      ?         Print a command summary
        !          1610:      !_c_o_m_m_a_n_d  Pass _c_o_m_m_a_n_d to the shell for execution
        !          1611: #make
        !          1612: mmaakkee -- Program building discipline
        !          1613: 
        !          1614: mmaakkee [_o_p_t_i_o_n ...] [_a_r_g_u_m_e_n_t ...] [_t_a_r_g_e_t ...]
        !          1615: 
        !          1616: _O_p_t_i_o_n_s:
        !          1617:      -dd        Debug mode
        !          1618:      -ee        Macro definitions in environment override those in makefile
        !          1619:      -ff _f_i_l_e   Instructions are in _f_i_l_e (default, [mmMM]aakkeeffiillee)
        !          1620:      -ii        Ignore command error returns
        !          1621:      -nn        Test: do all but execute commands
        !          1622:      -pp        Print macro definitions and target descriptions
        !          1623:      -qq        Only return exit status (zero if files up to date)
        !          1624:      -rr        Ignore built-in rules
        !          1625:      -ss        Do not print command lines when executed
        !          1626:      -tt        Update times of files without regenerating
        !          1627: #man
        !          1628: mmaann -- Print Lexicon entries
        !          1629: 
        !          1630: mmaann [-ww] [_t_o_p_i_c ...]
        !          1631: 
        !          1632: _O_p_t_i_o_n_s:
        !          1633:      -ww        Print only file name where document resides
        !          1634: 
        !          1635: With no arguments, list available topics.
        !          1636: #me
        !          1637: mmee -- MicroEMACS screen editor
        !          1638: 
        !          1639: mmee [-ee _e_r_r_o_r_f_i_l_e] [-ff _b_i_n_d_f_i_l_e] [_t_e_x_t_f_i_l_e ...]
        !          1640: 
        !          1641: _O_p_t_i_o_n_s:
        !          1642:      -ee _e_r_r_o_r_f_i_l_e
        !          1643:                Error-handling mode; read error messages from _e_r_r_o_r_f_i_l_e
        !          1644:      -ff _b_i_n_d_f_i_l_e
        !          1645:                Read keyboard bindings from _b_i_n_d_f_i_l_e
        !          1646: #mesg
        !          1647: mmeessgg -- Permit/deny messages from other users
        !          1648: 
        !          1649: mmeessgg [nnyy]
        !          1650: 
        !          1651: _O_p_t_i_o_n_s:
        !          1652:      nn         Disallow messages
        !          1653:      yy         Allow messages
        !          1654: 
        !          1655: With no arguments, mmeessgg prints the state.
        !          1656: #mkdir
        !          1657: mmkkddiirr -- Create a directory
        !          1658: 
        !          1659: mmkkddiirr [ -rr ] _d_i_r_e_c_t_o_r_y
        !          1660: 
        !          1661: _O_p_t_i_o_n:
        !          1662:      -rr        Make parent directories recursively as required
        !          1663: #mkfnames
        !          1664: mmkkffnnaammeess -- Generate data base of user names
        !          1665: 
        !          1666: mmkkffnnaammeess [_n_a_m_e_f_i_l_e  ...]
        !          1667: 
        !          1668: #mkfs
        !          1669: mmkkffss -- Make a new file system
        !          1670: 
        !          1671: /eettcc/mmkkffss [-bb _b_o_o_t] [-dd] [-ff _n_a_m_e] [-ii _i_n_o_d_e_s] [-mm _a_r_g] [-nn _a_r_g] [-pp _p_a_c_k] _f_i_l_e_s_y_s_t_e_m _p_r_o_t_o
        !          1672: 
        !          1673: _O_p_t_i_o_n_s:
        !          1674:      -bb _b_o_o_t   Specifies the file to use as the ``bootstrap'' for the file
        !          1675:                system.
        !          1676:      -dd        Preserve file dates and times.
        !          1677:      -ff _n_a_m_e   Label the file system with the given _n_a_m_e.  _n_a_m_e must be less
        !          1678:                than seven characters in length.
        !          1679:      -ii _i_n_o_d_e_s Use _i_n_o_d_e_s as the number of inodes for the file system.
        !          1680:      -mm _a_r_g    Number of blocks to skip when incrementing virtual block number
        !          1681:      -nn _a_r_g    Size of a ``virtual cylinder''
        !          1682:      -pp _p_a_c_k   Set the file system ``pack name'' to _p_a_c_k.  _p_a_c_k must be less
        !          1683:                than seven characters in length.
        !          1684: 
        !          1685: If _p_r_o_t_o is a number, it is the size in blocks of an empty file system;
        !          1686: otherwise, it names a prototype description file, as created by the command
        !          1687: bbaaddssccaann.
        !          1688: #mknod
        !          1689: mmkknnoodd -- Make a special file or named pipe
        !          1690: 
        !          1691: /eettcc/mmkknnoodd [ -ff ] _f_i_l_e_n_a_m_e _t_y_p_e _m_a_j_o_r _m_i_n_o_r
        !          1692: /eettcc/mmkknnoodd [ -ff ] _f_i_l_e_n_a_m_e pp
        !          1693: 
        !          1694: _O_p_t_i_o_n
        !          1695:      -ff        Forces creation of a new node, even if one of same name already
        !          1696:                exists
        !          1697: 
        !          1698: In first form of the command, _t_y_p_e is `b' for block special or `c' for
        !          1699: character special; _m_a_j_o_r and _m_i_n_o_r are numbers.  The second form creates a
        !          1700: named pipe with the given _f_i_l_e_n_a_m_e.
        !          1701: #modemcap
        !          1702: mmooddeemmccaapp -- Modem-description language
        !          1703: 
        !          1704: /eettcc/mmooddeemmccaapp
        !          1705: 
        !          1706: #modeminit
        !          1707: mmooddeemmiinniitt -- Initialize a modem
        !          1708: 
        !          1709: /uussrr/bbiinn/mmooddeemmiinniitt
        !          1710: 
        !          1711: #moo
        !          1712: mmoooo -- Greatly amusing numeric guessing game
        !          1713: 
        !          1714: /uussrr/ggaammeess/mmoooo [ _n_u_m_d_i_g_i_t_s ]
        !          1715: 
        !          1716: #more
        !          1717: mmoorree -- Display text one page at a time
        !          1718: 
        !          1719: mmoorree [ -ccddffllssuu ] [ -_w_i_n_d_o_w__s_i_z_e ] [ +_l_i_n_e__n_u_m_b_e_r ] [ +/_p_a_t_t_e_r_n ] [ _f_i_l_e ... ] [ - ]
        !          1720: 
        !          1721: _O_p_t_i_o_n_s:
        !          1722:      -         Read/display stdin
        !          1723:      -cc        Paint screen from top down
        !          1724:      -dd        Prompt user to quit after each screenful of text
        !          1725:      -ff        Count lines from file rather than screen-display lines
        !          1726:      -ll        Do not treat <ccttrrll-LL> as special
        !          1727:      -ss        Squeeze consecutive blank lines into one
        !          1728:      -uu        Display backspaces as control characters
        !          1729:      +lliinnee_nnuummbbeerr
        !          1730:                Begin display at _l_i_n_e__n_u_m_b_e_r
        !          1731:      +/ppaatttteerrnn Begin display at first line to contain _p_a_t_t_e_r_n
        !          1732: #motd
        !          1733: mmoottdd -- File that holds message of the day
        !          1734: 
        !          1735: /eettcc/mmoottdd
        !          1736: 
        !          1737: #mount.all
        !          1738: mmoouunntt.aallll -- Mount file systems at boot time
        !          1739: 
        !          1740: /eettcc/mmoouunntt.aallll
        !          1741: 
        !          1742: #mount
        !          1743: mmoouunntt -- Mount a file system
        !          1744: 
        !          1745: /eettcc/mmoouunntt [ _s_p_e_c_i_a_l _d_i_r_e_c_t_o_r_y [ -rruu ] ]
        !          1746: 
        !          1747: _O_p_t_i_o_n_s:
        !          1748:      -rr        Mount device read-only
        !          1749:      -uu        Update /eettcc/mmttaabb entry but do not mount device
        !          1750: 
        !          1751: With no arguments, print devices currently mounted.  _s_p_e_c_i_a_l names a device-
        !          1752: special file; _d_i_r_e_c_t_o_r_y names the directory on which to mount it.  File
        !          1753: /bbiinn/mmoouunntt contains useful abbreviations for invoking /eettcc/mmoouunntt.
        !          1754: #msg
        !          1755: mmssgg -- Send a brief message to other users
        !          1756: 
        !          1757: mmssgg _u_s_e_r
        !          1758: _m_e_s_s_a_g_e
        !          1759: 
        !          1760: #msgs
        !          1761: mmssggss -- Read messages intended for all COHERENT users
        !          1762: 
        !          1763: mmssggss [-_q] [_n_u_m_b_e_r]
        !          1764: 
        !          1765: _O_p_t_i_o_n_s:
        !          1766:      -qq        Query if new message is waiting to be read
        !          1767:      _n_u_m_b_e_r    Print message titled with given _n_u_m_b_e_r
        !          1768: 
        !          1769: To submit a message to mmssggss, mail it to user mmssggss.
        !          1770: #mv
        !          1771: mmvv -- Rename files or directories
        !          1772: 
        !          1773: mmvv [-ff] _o_l_d_f_i_l_e [_n_e_w_f_i_l_e]
        !          1774: mmvv [-ff] _f_i_l_e ... _d_i_r_e_c_t_o_r_y
        !          1775: 
        !          1776: _O_p_t_i_o_n:
        !          1777:      -ff        Force: remove _n_e_w_f_i_l_e even if unwritable
        !          1778: #mvdir
        !          1779: mmvvddiirr -- Rename a directory
        !          1780: 
        !          1781: /eettcc/mmvvddiirr _o_l_d_d_i_r _n_e_w_d_i_r
        !          1782: 
        !          1783: #ncheck
        !          1784: nncchheecckk -- Print file names corresponding to i-node
        !          1785: 
        !          1786: nncchheecckk [ -ii _n_u_m_b_e_r ... ] [ -aass ] _f_i_l_e_s_y_s_t_e_m ...
        !          1787: 
        !          1788: _O_p_t_i_o_n_s:
        !          1789:      -aa        Print file names including `.' and `..'
        !          1790:      -ii _n...   Print file names only for listed i-numbers _n...
        !          1791:      -ss        Print only special files and files with setuid mode
        !          1792: #newgrp
        !          1793: nneewwggrrpp -- Change to a new group
        !          1794: 
        !          1795: nneewwggrrpp _g_r_o_u_p
        !          1796: 
        !          1797: #newusr
        !          1798: nneewwuussrr -- Add new user to COHERENT system
        !          1799: 
        !          1800: /eettcc/nneewwuussrr _l_o_g_i_n "_U_s_e_r _N_a_m_e" _p_a_r_e_n_t_d_i_r [ _s_h_e_l_l ]
        !          1801: 
        !          1802: #nm
        !          1803: nnmm -- Print a program's symbol table
        !          1804: 
        !          1805: nnmm [ -aaddggnnoopprruu ] _f_i_l_e ...
        !          1806: 
        !          1807: _O_p_t_i_o_n_s:
        !          1808:      -aa        Print all symbols
        !          1809:      -dd        Print only definitions
        !          1810:      -gg        Print only global symbols
        !          1811:      -nn        Sort numerically (default, sort by name)
        !          1812:      -oo        Prepend file or member name to each line
        !          1813:      -pp        Print in symbol table order (no sort)
        !          1814:      -rr        Reverse order of sort
        !          1815:      -uu        Print undefined symbols
        !          1816: 
        !          1817: _f_i_l_e may be an object file or an archive.
        !          1818: #nptx
        !          1819: nnppttxx -- Generate permutations of users' full names
        !          1820: 
        !          1821: nnppttxx
        !          1822: 
        !          1823: #nroff
        !          1824: nnrrooffff -- Text-formatting language
        !          1825: 
        !          1826: nnrrooffff [_o_p_t_i_o_n ...] [_f_i_l_e ...]
        !          1827: 
        !          1828: _O_p_t_i_o_n_s:
        !          1829:      -dd        Debug: print each request before executing
        !          1830:      -ff _n_a_m_e   Write temporary file in file _n_a_m_e
        !          1831:      -ii        Read stdin after each _f_i_l_e has been read
        !          1832:      -kk        Keep temporary file
        !          1833:      -mm_n_a_m_e    Read macro package /uussrr/lliibb/ttmmaacc._n_a_m_e
        !          1834:      -nn_N       Number first page of output _N (default, 1)
        !          1835:      -rr_a_N      Set number register _a to value _N
        !          1836:      -rr_a_b_N     Set number register _a_b to value _N; for obvious reasons, _a_b
        !          1837:                cannot contain a digit
        !          1838:      -xx        Do not eject to bottom of final page
        !          1839: #od
        !          1840: oodd -- Print an octal dump of a file
        !          1841: 
        !          1842: oodd [-bbccddooxx] [_f_i_l_e] [ [+] _o_f_f_s_e_t[.][bb] ]
        !          1843: 
        !          1844: _O_p_t_i_o_n_s:
        !          1845:      -bb        Dump bytes in the default base
        !          1846:      -cc        Dump bytes as ASCII characters
        !          1847:      -dd        Dump words in decimal
        !          1848:      -oo        Dump words in octal
        !          1849:      -xx        Dump words in hexadecimal
        !          1850: 
        !          1851: Default base is octal on the PDP-11; hexadecimal on the i80286, Z-8001, and
        !          1852: M68000.  _o_f_f_s_e_t must be preceded by `+' if _f_i_l_e is omitted.  _o_f_f_s_e_t is decimal
        !          1853: if `.' is present; `b' implies 512-byte blocks instead of bytes.
        !          1854: #passwd
        !          1855: ppaasssswwdd -- Set/change login password
        !          1856: 
        !          1857: ppaasssswwdd [_u_s_e_r]
        !          1858: 
        !          1859: #paste
        !          1860: ppaassttee -- Merge lines of files
        !          1861: 
        !          1862: ppaassttee [-ss] [-dd _l_i_s_t] _f_i_l_e ...
        !          1863: 
        !          1864: _O_p_t_i_o_n_s:
        !          1865:      -ss        Display lines of input files sequentially across page
        !          1866:      -dd _l_i_s_t   Use _l_i_s_t as delimiters for output fields
        !          1867: #patch
        !          1868: ppaattcchh -- Modify portions of an executable
        !          1869: 
        !          1870: /ccoonnff/ppaattcchh [-kk] _i_m_a_g_e _s_y_m_b_o_l=_v_a_l_u_e ...
        !          1871: 
        !          1872: _O_p_t_i_o_n_s:
        !          1873:      -kk        Patch the kernel's data memory of the running system via device
        !          1874:                /ddeevv/kkmmeemm.
        !          1875: #pax
        !          1876: ppaaxx -- Portable archive interchange
        !          1877: 
        !          1878: 
        !          1879: The options are the same as those for the command ttaarr.
        !          1880: #phone
        !          1881: pphhoonnee -- Print numbers and addresses from phone directory
        !          1882: 
        !          1883: pphhoonnee _p_e_r_s_o_n ...
        !          1884: 
        !          1885: #popd
        !          1886: ppooppdd -- Pop an item from the directory stack
        !          1887: 
        !          1888: ppooppdd [_i_t_e_m ... ]
        !          1889: 
        !          1890: sshh only.
        !          1891: #pr
        !          1892: pprr -- Paginate and print files
        !          1893: 
        !          1894: pprr [ _o_p_t_i_o_n_s ] [ _f_i_l_e ...]
        !          1895: 
        !          1896: _O_p_t_i_o_n_s:
        !          1897:      +_s_k_i_p     Skip the first _s_k_i_p pages of input before printing
        !          1898:      -_c_o_l_s     Print the input in _c_o_l_s columns
        !          1899:      -hh        The next argument is the header (replaces file name)
        !          1900:      -ll_n       Set page size to _n lines (default, 66)
        !          1901:      -mm        Print each input _f_i_l_e in a separate column
        !          1902:      -nn        Number the output lines
        !          1903:      -ss_c       Separate each column with character _c
        !          1904:      -tt        Suppress top and bottom margins and header
        !          1905:      -ww_n       Page width is set to _n columns (default, 80)
        !          1906: 
        !          1907: A _f_i_l_e named `-' means stdin.
        !          1908: #prep
        !          1909: pprreepp -- Produce a word list
        !          1910: 
        !          1911: pprreepp [ -ddffpp ] [ -ii _i_f_i_l_e ] [ -oo _o_f_i_l_e ] [ _f_i_l_e ... ]
        !          1912: 
        !          1913: _O_p_t_i_o_n_s:
        !          1914:      -dd        Print number of each word output
        !          1915:      -ff        Fold upper case to lower case
        !          1916:      -ii _f_i_l_e   Ignore all words in _f_i_l_e on output
        !          1917:      -oo _f_i_l_e   Output only words from _f_i_l_e
        !          1918:      -pp        Print punctuation marks on separate lines (not numbered)
        !          1919: 
        !          1920: Text is taken from each input _f_i_l_e or stdin if none.  Words consist of
        !          1921: alphabetic characters and apostrophes.
        !          1922: #print
        !          1923: pprriinntt -- Echo text onto the standard output
        !          1924: 
        !          1925: pprriinntt [-eennrruu_n] [_a_r_g_u_m_e_n_t ...]
        !          1926: 
        !          1927: _O_p_t_i_o_n_s:
        !          1928:      -ee        Re-enable expansion of C escape sequences
        !          1929:      -nn        Don't print newline after list of arguments
        !          1930:      -rr        Suppress expansion of C escape sequences
        !          1931:      -uu_n       Redirect output file descriptor _n
        !          1932: 
        !          1933: kksshh only.
        !          1934: #prof
        !          1935: pprrooff -- Print execution profile of a C program
        !          1936: 
        !          1937: pprrooff [ -aabbccss ][ _p_r_o_g_f_i_l_e [ _m_o_n_f_i_l_e ] ]
        !          1938: 
        !          1939: _O_p_t_i_o_n_s:
        !          1940:      -aa        Use all symbols, not just externals
        !          1941:      -bb        Print all bin information
        !          1942:      -cc        Print all call information
        !          1943:      -ss        Report stack usage high water mark
        !          1944: 
        !          1945: The default _p_r_o_g_f_i_l_e is ll.oouutt; the default _m_o_n_f_i_l_e, mmoonn.oouutt.
        !          1946: #profile
        !          1947: pprrooffiillee -- Set user's environment at login
        !          1948: 
        !          1949: /eettcc/pprrooffiillee
        !          1950: 
        !          1951: #.profile
        !          1952: .pprrooffiillee -- Set user's personal environment at login
        !          1953: 
        !          1954: $HHOOMMEE/.pprrooffiillee
        !          1955: 
        !          1956: #prps
        !          1957: pprrppss -- Prepare files for PostScript-compatible printer
        !          1958: 
        !          1959: pprrppss [_o_p_t_i_o_n_s] [_f_i_l_e ... ]
        !          1960: 
        !          1961: _O_p_t_i_o_n_s:
        !          1962:      -_p_t_s_i_z_e   Use _p_t_s_i_z_e as the point size (default, 10)
        !          1963:      -bb        Suppress the box around the page text
        !          1964:      -ff_f_o_n_t    Use the given font name (default, Courier)
        !          1965:      -FF_X       Use font X, which must be [ABHNPST]
        !          1966:      -FF_s_f_x     Use _s_f_x as suffix for font X, which must be [RRBBII].  Default
        !          1967:                suffixes are "" (R), -BBoolldd (B), -OObblliiqquuee (I)
        !          1968:      -hh        Suppress the header line
        !          1969:      -ll        Landscape mode (default, portrait)
        !          1970:      -ll22       Landscape mode, two pages per output page
        !          1971:      -nn_h_e_a_d    Use _h_e_a_d in header line
        !          1972:      -pp_N       Print _N lines of text per output page
        !          1973:      -tt_N       Set tab stops to every _N characters (default, 8)
        !          1974:      +_N        Skip first _N output pages
        !          1975: #ps
        !          1976: ppss -- Print process status
        !          1977: 
        !          1978: ppss [ -aaffggllmmnnrrttwwxx ] [ -cc _s_y_s ] [ -kk _m_e_m ]
        !          1979: 
        !          1980: _O_p_t_i_o_n_s:
        !          1981:      -aa        Print all terminals' processes
        !          1982:      -cc _s_y_s    Next argument is system (default, /ccoohheerreenntt)
        !          1983:      -dd        Print status of loadable drivers
        !          1984:      -ff        Put `-' in null fields for placeholders
        !          1985:      -gg        Give group leader for this process
        !          1986:      -kk _m_e_m    Next argument is memory image (default, /ddeevv/mmeemm)
        !          1987:      -ll        Print long format
        !          1988:      -mm        Print scheduling information
        !          1989:      -nn        No header line
        !          1990:      -rr        Give the real size of the process
        !          1991:      -tt        Print CPU times
        !          1992:      -ww        Wide column format (132 columns instead of default 80)
        !          1993:      -xx        Print processes with no controlling tty
        !          1994: #pushd
        !          1995: ppuusshhdd -- Push an item onto the directory stack
        !          1996: 
        !          1997: ppuusshhdd [_d_i_r_e_c_t_o_r_y_0 ... _d_i_r_e_c_t_o_r_y_N]
        !          1998: 
        !          1999: sshh only.
        !          2000: #pwd
        !          2001: ppwwdd -- Print the name of the current directory
        !          2002: 
        !          2003: ppwwdd
        !          2004: 
        !          2005: #qfind
        !          2006: qqffiinndd -- Quickly find all files with a given name
        !          2007: 
        !          2008: qqffiinndd [-aaddpp] _n_a_m_e ...
        !          2009: qqffiinndd [-bb]
        !          2010: 
        !          2011: _O_p_t_i_o_n_s:
        !          2012:      -aa        All: search for files or directories
        !          2013:      -bb        Build file data base
        !          2014:      -dd        Search for directories only
        !          2015:      -pp        Partial name matching
        !          2016: 
        !          2017: Run as rroooott when using -bb to find everything.
        !          2018: #quot
        !          2019: qquuoott -- Summarize file-system usage
        !          2020: 
        !          2021: qquuoott [ -cc ] [ -ff ] [ -nn ] [ -tt ] _f_i_l_e_s_y_s_t_e_m
        !          2022: 
        !          2023: _O_p_t_i_o_n_s:
        !          2024:      -cc        Print file size, number of files of size, and cumulative total
        !          2025:                blocks up to size
        !          2026:      -ff        Print number of files plus number of blocks per user
        !          2027:      -nn        Input (i-number, file system) pairs one per line; output owners
        !          2028:                and file names (e.g.: nncchheecckk ffss | ssoorrtt +00nn | qquuoott -nn ffss)
        !          2029:      -tt        Print totals (where applicable)
        !          2030: 
        !          2031: Options -cc and -nn are disjoint from other options.  Only the superuser rroooott can
        !          2032: run qquuoott.
        !          2033: #ramdisk
        !          2034: rraammddiisskk -- Script to create a RAM-disk
        !          2035: 
        !          2036: /uussrr/bbiinn/rraammddiisskk
        !          2037: 
        !          2038: #ranlib
        !          2039: rraannlliibb -- Create index for object library
        !          2040: 
        !          2041: rraannlliibb _l_i_b_r_a_r_y ...
        !          2042: 
        !          2043: #rc
        !          2044: rrcc -- Perform standard maintenance chores
        !          2045: 
        !          2046: /eettcc/rrcc
        !          2047: 
        !          2048: #read
        !          2049: rreeaadd -- Assign values to shell variables
        !          2050: 
        !          2051: rreeaadd _n_a_m_e ...
        !          2052: 
        !          2053: Reads a line from stdin and assign each token to corresponding shell variable
        !          2054: _n_a_m_e.  The shell executes rreeaadd directly.
        !          2055: #readonly
        !          2056: rreeaaddoonnllyy -- Mark a shell variable as read only
        !          2057: 
        !          2058: rreeaaddoonnllyy
        !          2059: 
        !          2060: #reboot
        !          2061: rreebboooott -- Reboot the COHERENT system
        !          2062: 
        !          2063: /eettcc/rreebboooott [ -pp ]
        !          2064: 
        !          2065: _O_p_t_i_o_n:
        !          2066:      -pp        Prompt user if she really wishes to reboot
        !          2067: #ref
        !          2068: rreeff -- Display a C function header
        !          2069: 
        !          2070: rreeff _f_u_n_c_t_i_o_n
        !          2071: 
        !          2072: #restor
        !          2073: rreessttoorr -- Restore file system
        !          2074: 
        !          2075: rreessttoorr _c_o_m_m_a_n_d [_d_u_m_p__d_e_v_i_c_e] [_f_i_l_e_s_y_s_t_e_m] [_f_i_l_e ...]
        !          2076: 
        !          2077: _O_p_t_i_o_n_s:
        !          2078:      ff         Next argument names the dump device
        !          2079:      rr         Mass restore (also RR)
        !          2080:      tt         Print taken and since dates of the dump
        !          2081:      vv         Verbose (print commentary during mass restore)
        !          2082:      xx         Selective extract of argument files (also `X')
        !          2083: #rev
        !          2084: rreevv -- Print text backwards
        !          2085: 
        !          2086: rreevv [_f_i_l_e ...]
        !          2087: 
        !          2088: #rm
        !          2089: rrmm -- Remove files
        !          2090: 
        !          2091: rrmm [ -ffiirrttvv ] _f_i_l_e ...
        !          2092: 
        !          2093: _O_p_t_i_o_n_s:
        !          2094:      -ff        Force: remove unwritable files, suppress error messages and
        !          2095:                prompts
        !          2096:      -ii        Ask before removing each file
        !          2097:      -rr        Recursively remove entire directory structure
        !          2098:      -tt        Test: perform all checks but do not remove files
        !          2099:      -vv        Verbose: report the disposition of each file
        !          2100: #rmail
        !          2101: rrmmaaiill -- Receive UUCP mail
        !          2102: 
        !          2103: rrmmaaiill [-LLllRRrr] -qq _n_u_m -uu _u_u_x_f_l_a_g_s _a_d_d_r_e_s_s ...
        !          2104: 
        !          2105: _O_p_t_i_o_n_s:
        !          2106:      -LL        Send all addresses to the local mailer for processing
        !          2107:      -ll        Send a domain address to the local mailer for processing
        !          2108:      -qq _n_u_m    Reset the queueing threshold to _n_u_m
        !          2109:      -RR        Reroute UUCP paths
        !          2110:      -rr        Route the first component of a UUCP path in addition to routing
        !          2111:                domain addresses
        !          2112:      -uu _u_u_x_f_l_a_g_s
        !          2113:                Pass _u_u_x_f_l_a_g_s to uuuuxx
        !          2114: #rmdir
        !          2115: rrmmddiirr -- Remove directories
        !          2116: 
        !          2117: rrmmddiirr [ -ff ] _d_i_r_e_c_t_o_r_y ...
        !          2118: 
        !          2119: _O_p_t_i_o_n:
        !          2120:      -ff        Force: remove a file without interactive checking
        !          2121: #rubik
        !          2122: rruubbiikk -- Play Rubik's cube
        !          2123: 
        !          2124: /uussrr/ggaammeess/rruubbiikk
        !          2125: 
        !          2126: #sa
        !          2127: ssaa -- Print a summary of process accounting
        !          2128: 
        !          2129: ssaa [-aabbccjjllmmnnrrssttuu] [-vv _N] [_f_i_l_e]
        !          2130: 
        !          2131: _O_p_t_i_o_n_s:
        !          2132:      -aa        Commands seen once or unprintable called ***ootthheerr
        !          2133:      -bb        Sort by average CPU time per call
        !          2134:      -cc        Print CPU time as percentage of all CPU time used
        !          2135:      -jj        Print average times per call, not totals
        !          2136:      -ll        Separate user and system times
        !          2137:      -mm        Information per user, not per command
        !          2138:      -nn        Sort by number of calls
        !          2139:      -rr        Reverse sort
        !          2140:      -ss        Condense the information
        !          2141:      -tt        Print CPU time as percentage of real time
        !          2142:      -uu        Print user and command directly from raw file
        !          2143:      -vv_N       If called no more than _N times, put it into **jjuunnkk**
        !          2144: 
        !          2145: The default _f_i_l_e is /uussrr/aaddmm/aacccctt.
        !          2146: #scat
        !          2147: ssccaatt -- Print text files one screenful at a time
        !          2148: 
        !          2149: ssccaatt [ [_o_p_t_i_o_n ...] [_f_i_l_e ... ] ] ...
        !          2150: 
        !          2151: _O_p_t_i_o_n_s:
        !          2152:      -11        Do not stop at EOF if exactly one file specified
        !          2153:      -bb_n       Begin output at line _n
        !          2154:      -cc        Mark control characters (overrides -tt)
        !          2155:      -ccss       Like -cc, but map space to underscore `_', and prefix underscore
        !          2156:                with `\'
        !          2157:      -cctt       Like -cc, but map tabs to spaces
        !          2158:      -iinn       Skip _n columns on output
        !          2159:      -llnn       Set screen length to _n lines
        !          2160:      -nn        Number input lines
        !          2161:      -rr        Remote; no paging
        !          2162:      -ss        Squash empty lines
        !          2163:      -SS_n       Seek _n bytes into input before processing
        !          2164:      -tt        Truncate lines to line length (default, wraparound)
        !          2165:      -ww_n       Set screen width to _n columns
        !          2166:      -xx        Expand tabs
        !          2167: _C_o_m_m_a_n_d_s:
        !          2168:      <rreettuurrnn>  Next page
        !          2169:      <ssppaaccee>   Next line
        !          2170:      /         Next half page
        !          2171:      ff         Print file names and line number
        !          2172:      nn         Next file
        !          2173:      qq         Quit
        !          2174: #sed
        !          2175: sseedd -- Stream editor
        !          2176: 
        !          2177: sseedd [ -nn ] [-ee _c_o_m_m_a_n_d] [-ff _s_c_r_i_p_t] ... _f_i_l_e ...
        !          2178: 
        !          2179: _O_p_t_i_o_n_s:
        !          2180:      -ee        Direct command follows
        !          2181:      -ff        File name of command script follows
        !          2182:      -nn        No implicit output
        !          2183: #set
        !          2184: sseett -- Set shell option flags and positional parameters
        !          2185: 
        !          2186: sseett [-cceeiikknnssttuuvvxx [_n_a_m_e ...] ] (Bourne shell)
        !          2187: sseett [[+-]aaeeffhhkkmmnnuuvvxx] [[+-]oo _n_a_m_e] (Korn shell)
        !          2188: 
        !          2189: _O_p_t_i_o_n_s:
        !          2190:      -aa        Automatically export all new variables (kksshh)
        !          2191:      -cc _s_t_r_i_n_g Read commands from _s_t_r_i_n_g (sshh)
        !          2192:      -ee        Exit on any error
        !          2193:      -ff        Noglob:  Don't expand file names (kksshh)
        !          2194:      -hh        Automatically add all commands to hash table (kksshh)
        !          2195:      -ii        Shell is always interactive (sshh)
        !          2196:      -kk        Place all keyword arguments into environment (sshh)
        !          2197:      -kk        Recognize variables anywhere in command (kksshh)
        !          2198:      -mm        Enable job control (kksshh)
        !          2199:      -nn        Read commands but do not execute
        !          2200:      -oo _o_p_t_i_o_n Set _o_p_t_i_o_n (kksshh)
        !          2201:      -ss        Read commands from stdin; write to stderr (sshh)
        !          2202:      -tt        Read one command rather than entire file (sshh)
        !          2203:      -uu        If variable is blank, report error
        !          2204:      -vv        Print each line as it is read
        !          2205:      -xx        Print each command as it's executed
        !          2206:      -         Cancel -vv and -xx options (sshh)
        !          2207: 
        !          2208: With kksshh, prefixing an option with `+' turns it on; prefixing it with `-' turns
        !          2209: it off.
        !          2210: #sh
        !          2211: sshh -- The Bourne shell
        !          2212: 
        !          2213: sshh [-cceeiikknnssttuuvvxx] _t_o_k_e_n ...
        !          2214: 
        !          2215: _O_p_t_i_o_n_s:
        !          2216:      -cc _c_m_d_s   Read commands from _c_m_d_s
        !          2217:      -ee        Exit on any error if noninteractive
        !          2218:      -ii        Interactive even if no tty attached
        !          2219:      -kk        Place all keyword args into global environment
        !          2220:      -nn        Read commands but do not execute them
        !          2221:      -ss        Read commands from stdin, write output to stderr
        !          2222:      -tt        Read and execute one command only
        !          2223:      -uu        Report error if actual value of shell variable is null
        !          2224:      -vv        Print each line as read
        !          2225:      -xx        Print each command and argument as executed
        !          2226:      -         Cancel -vv and -xx options
        !          2227: 
        !          2228: The following reserved tokens may not be used in the first position of the
        !          2229: command unless quoted:
        !          2230: 
        !          2231:         ccaassee ddoo ddoonnee eelliiff eellssee ffii ffoorr iinn tthheenn uunnttiill wwhhiillee { } ( )
        !          2232: 
        !          2233: If the first token is not reserved, it is treated as the name of a command.
        !          2234: The remaining tokens are treated as arguments.  The characters * ? [ ] specify
        !          2235: patterns that match file names.  To quote characters or strings, these escape
        !          2236: characters are provided:
        !          2237: 
        !          2238:         '...' "..." \
        !          2239: 
        !          2240: Each _t_o_k_e_n, unless quoted, is checked for substitutions.
        !          2241: #shift
        !          2242: sshhiifftt -- Shift positional parameters
        !          2243: 
        !          2244: sshhiifftt
        !          2245: 
        !          2246: The shell executes sshhiifftt directly.
        !          2247: #shutdown
        !          2248: sshhuuttddoowwnn -- Shut down the COHERENT system
        !          2249: 
        !          2250: /eettcc/sshhuuttddoowwnn
        !          2251: 
        !          2252: #size
        !          2253: ssiizzee -- Print size of an object file
        !          2254: 
        !          2255: ssiizzee [_f_i_l_e ...]
        !          2256: 
        !          2257: #sleep
        !          2258: sslleeeepp -- Stop executing for a specified time
        !          2259: 
        !          2260: sslleeeepp _s_e_c_o_n_d_s
        !          2261: 
        !          2262: #smail
        !          2263: ssmmaaiill -- Send UUCP mail
        !          2264: 
        !          2265: ssmmaaiill [-AAccddLLllRRrrvv] -aa _a_l_i_a_s_f_i_l_e -FF _a_d_d_r_e_s_s -HH [_h_o_s_t_d_o_m_a_i_n] \
        !          2266:         -hh [_h_o_s_t] -mm _n_u_m -nn [_n_a_m_e_l_i_s_t] -pp _p_a_t_h_f_i_l_e \
        !          2267:         -qq _n_u_m -uu _u_u_x_f_l_a_g_s _a_d_d_r_e_s_s ...
        !          2268: 
        !          2269: _O_p_t_i_o_n_s:
        !          2270:      -AA        Print the resolved UUCP addresses; do not collect mail
        !          2271:      -aa _a_l_i_a_s_f_i_l_e
        !          2272:                Read _a_l_i_a_s_f_i_l_e
        !          2273:      -cc        Check /uussrr/lliibb/mmaaiill/ppaatthhss for the cost of mailing a message to a
        !          2274:                given host
        !          2275:      -dd        Give a verbose description; do not invoke other mailers
        !          2276:      -FF _a_d_d_r_e_s_s
        !          2277:                Use _a_d_d_r_e_s_s on the FFrroomm: line
        !          2278:      -HH _h_o_s_t_d_o_m_a_i_n
        !          2279:                Set the host's domain
        !          2280:      -hh _h_o_s_t_n_a_m_e
        !          2281:                Set a _h_o_s_t_n_a_m_e
        !          2282:      -LL        Send all addresses to the local mailer for processing
        !          2283:      -ll        Send a domain address to the local mailer for processing
        !          2284:      -mm _n_u_m    Send no more than _n_u_m jobs to uuuuxx
        !          2285:      -nn [_n_a_m_e_l_i_s_t]
        !          2286:                Use name-list style aliasing
        !          2287:      -pp _p_a_t_h_f_i_l_e
        !          2288:                Read _p_a_t_h_f_i_l_e instead of /uussrr/lliibb/mmaaiill/ppaatthhss
        !          2289:      -qq _n_u_m    Set the queuing threshold to _n_u_m
        !          2290:      -RR        Reroute UUCP paths
        !          2291:      -rr        Route the first component of a UUCP path in addition to routing
        !          2292:                domain addresses
        !          2293:      -uu _u_u_x_f_l_a_g_s
        !          2294:                Pass _u_u_x_f_l_a_g_s to uuuuxx
        !          2295:      -vv        Give verbose description, but invoke other mailers
        !          2296: #sort
        !          2297: ssoorrtt -- Sort lines of text
        !          2298: 
        !          2299: ssoorrtt [-bbccddffiimmnnrruu] [-tt _c] [-oo _o_u_t_f_i_l_e] [-TT _d_i_r] [+_b_e_g[-_e_n_d]][_f_i_l_e ...]
        !          2300: 
        !          2301: _O_p_t_i_o_n_s:
        !          2302:      -cc        Check if input is already ordered
        !          2303:      -mm        Merge already-sorted input files
        !          2304:      -oo _n_a_m_e   Place output in _n_a_m_e, not stdout
        !          2305:      -tt_c       Tab character is _c
        !          2306:      -TT _d_i_r    Use _d_i_r for temporary files
        !          2307:      -uu        Output only records with unique keys
        !          2308: _K_e_y _o_p_t_i_o_n_s:
        !          2309:      -bb        Skip leading blanks in fields
        !          2310:      -dd        Dictionary ordering for keys
        !          2311:      -ff        Fold upper case into lower case in key comparison
        !          2312:      -ii        Ignore control characters in key comparison
        !          2313:      -nn        Numeric comparison
        !          2314:      -rr        Reverse sort ordering
        !          2315: _P_o_s_i_t_i_o_n:
        !          2316:      +_m._n_f     Key starts _m fields into record and _n characters into that
        !          2317:                field; _f may contain optional flags from key options above which
        !          2318:                apply only to that positional
        !          2319:      -_m._n_f     Optional ending position of key (same form as above)
        !          2320: 
        !          2321: If no _f_i_l_e is given, sort stdin.
        !          2322: #spell
        !          2323: ssppeellll -- Find spelling errors
        !          2324: 
        !          2325: ssppeellll [-aa][-bb][_f_i_l_e ...]
        !          2326: 
        !          2327: _O_p_t_i_o_n_s:
        !          2328:      -aa        Use American variant of the dictionary (default)
        !          2329:      -bb        Use British variant of the dictionary
        !          2330: #split
        !          2331: sspplliitt -- Split a text file into smaller files
        !          2332: 
        !          2333: sspplliitt [-_n_l_i_n_e_s][-cc_c_o_u_n_t][_i_n_f_i_l_e [_o_u_t_f_i_l_e] ]
        !          2334: 
        !          2335: If _i_n_f_i_l_e _i_s `-' _o_r _n_o _i_n_f_i_l_e, stdin is read.  _o_u_t_f_i_l_e defaults to xx.  _n_l_i_n_e_s
        !          2336: is number of lines for text files, _c_o_u_n_t is the character count for binary
        !          2337: files.
        !          2338: #srcpath
        !          2339: ssrrccppaatthh -- Find source files
        !          2340: 
        !          2341: ssrrccppaatthh [-aaww] [-pp _p_a_t_h] _f_i_l_e_n_a_m_e _p_a_t_t_e_r_n ...
        !          2342: 
        !          2343: _O_p_t_i_o_n_s:
        !          2344:      -aa        Disable shadowing: print all instances of file it finds along
        !          2345:                SSRRCCPPAATTHH, not just first
        !          2346:      -pp _p_a_t_h   Use _p_a_t_h instead of SSRRCCPPAATTHH
        !          2347:      -ww        Print warning when you lack permission to read file or directory
        !          2348: #strings
        !          2349: ssttrriinnggss -- Print all character strings from a file
        !          2350: 
        !          2351: ssttrriinnggss [-ddooppxx] [-_l_e_n_g_t_h] [_f_i_l_e ... ]
        !          2352: 
        !          2353: _O_p_t_i_o_n_s:
        !          2354:      -dd        Print offset of each string in decimal
        !          2355:      -oo        Print offset of each string in octal
        !          2356:      -pp        Mask out the parity bit
        !          2357:      -xx        Print offset of each string in hexadecimal
        !          2358: #strip
        !          2359: ssttrriipp -- Strip tables from executable file
        !          2360: 
        !          2361: ssttrriipp -ddrrss _f_i_l_e [...]
        !          2362: 
        !          2363: _O_p_t_i_o_n_s:
        !          2364:      -dd        Keep debug information
        !          2365:      -rr        Keep relocation information
        !          2366:      -ss        Keep symbols
        !          2367: #stty
        !          2368: ssttttyy -- Set/print terminal modes
        !          2369: 
        !          2370: ssttttyy [_o_p_t_i_o_n ...]
        !          2371: 
        !          2372: _O_p_t_i_o_n_s:
        !          2373:      99660000      Baud rate: any valid terminal speed accepted
        !          2374:      00         Hang up phone immediately
        !          2375:      [bbrreeaakk|eeooff|eerraassee|iinntteerrrruupptt|kkiillll|qquuiitt|ssttaarrtt|ssttoopp] _c
        !          2376:                Set specified character to _c
        !          2377:      aallll       Display all modes
        !          2378:      ccbbrreeaakk    Enable break after every input character
        !          2379:      -ccbbrreeaakk   Disable break after every input character
        !          2380:      ccrrtt       Enable crt character erasing
        !          2381:      -ccrrtt      Disable crt character erasing
        !          2382:      eecchhoo      Enable input character echoing
        !          2383:      -eecchhoo     Disable input character echoing
        !          2384:      eevveenn      Enable even parity
        !          2385:      -eevveenn     Disable even parity
        !          2386:      eexxccll      Enable exclusive use
        !          2387:      -eexxccll     Disable exclusive use
        !          2388:      fflluusshh     Flush input queues
        !          2389:      -fflluusshh    Do not flush input queues
        !          2390:      hhuupp       Enable hang up on last close
        !          2391:      -hhuupp      Disable hang up on last close
        !          2392:      nnll        Disable newline mapping
        !          2393:      -nnll       Enable newline mapping
        !          2394:      oodddd       Enable odd parity
        !          2395:      -oodddd      Disable odd parity
        !          2396:      pprriinntt     Print terminal attributes
        !          2397:      rraaww       Enable raw mode
        !          2398:      -rraaww      Disable raw mode
        !          2399:      ssaannee      Set terminal to a known state
        !          2400:      ttaabbss      Disable tab expansion
        !          2401:      -ttaabbss     Enable tab expansion
        !          2402:      ttaannddeemm    Enable tandem (start/stop) mode
        !          2403:      -ttaannddeemm   Disable tandem (start/stop) mode
        !          2404: 
        !          2405: If no _o_p_t_i_o_n is specified, ssttttyy prints the modes of the standard-output device
        !          2406: on stderr.
        !          2407: #su
        !          2408: ssuu -- Substitute user id, become superuser
        !          2409: 
        !          2410: ssuu [_u_s_e_r [_c_o_m_m_a_n_d] ]
        !          2411: 
        !          2412: #sum
        !          2413: ssuumm -- Print checksum of a file
        !          2414: 
        !          2415: ssuumm [_f_i_l_e ...]
        !          2416: 
        !          2417: #sync
        !          2418: ssyynncc -- Flush system buffers
        !          2419: 
        !          2420: ssyynncc
        !          2421: 
        !          2422: #tail
        !          2423: ttaaiill -- Print the end of a file
        !          2424: 
        !          2425: ttaaiill [+_n[bbccffll]] [_f_i_l_e]
        !          2426: ttaaiill [-_n[bbccffll]] [_f_i_l_e]
        !          2427: 
        !          2428: _O_p_t_i_o_n_s:
        !          2429:      +_n        _n counts from beginning of file
        !          2430:      -_n        _n counts from end of file
        !          2431:      bb         _n is in blocks
        !          2432:      cc         _n is in characters (bytes)
        !          2433:      ff         Open tail of file, then display new material as it is added to
        !          2434:                the file.  File remains open until you type interrupt (usually
        !          2435:                <ccttrrll-CC>).
        !          2436:      ll         _n is in lines (default)
        !          2437: #tar
        !          2438: ttaarr -- V7 tape archive manager
        !          2439: 
        !          2440: ttaarr [ccrrttuuxx[00-77bbffllmmvvwwUU] [_b_l_o_c_k_s] [_a_r_c_h_i_v_e] _f_i_l_e ...
        !          2441: 
        !          2442: _D_i_r_e_c_t_i_v_e_s:
        !          2443:      cc         Create a new archive, overwriting any old contents
        !          2444:      rr         Replace (append) the named files in the archive
        !          2445:      tt         Write a table of contents of the archive to stdout
        !          2446:      uu         Update the archive (replace mode)
        !          2447:      xx         Extract the named files from the archive
        !          2448: _O_p_t_i_o_n_s:
        !          2449:      00-77       A single octal digit specifies a tape unit
        !          2450:      BB         Next argument is the blocking factor
        !          2451:      ff         Next argument is the archive name
        !          2452:      ll         Report broken links
        !          2453:      mm         Ignore the mmttiimmee for each extracted file
        !          2454:      UU         Tape written on a non-COHERENT system
        !          2455:      vv         Verbose flag
        !          2456:      ww         Interactive mode
        !          2457: #tee
        !          2458: tteeee -- Branch pipe output
        !          2459: 
        !          2460: tteeee [ -aa ] [ -ii ] [ _f_i_l_e ...]
        !          2461: 
        !          2462: _O_p_t_i_o_n_s:
        !          2463:      -aa        Append to each output _f_i_l_e
        !          2464:      -ii        Ignore interrupts
        !          2465: #termcap
        !          2466: tteerrmmccaapp -- Terminal-description language
        !          2467: 
        !          2468: /eettcc/tteerrmmccaapp
        !          2469: 
        !          2470: #terminfo
        !          2471: tteerrmmiinnffoo -- terminal description language
        !          2472: 
        !          2473: /uussrr/lliibb/tteerrmmiinnffoo
        !          2474: 
        !          2475: #test
        !          2476: tteesstt -- Evaluate conditional expression
        !          2477: 
        !          2478: tteesstt _e_x_p_r_e_s_s_i_o_n ...
        !          2479: 
        !          2480: _O_p_t_i_o_n_s:
        !          2481:      _e_x_p_1 -aa _e_x_p_2
        !          2482:                Both expressions are true
        !          2483:      -bb _f_i_l_e   _f_i_l_e is block-special (kksshh)
        !          2484:      -cc _f_i_l_e   _f_i_l_e is character-special (kksshh)
        !          2485:      -dd _f_i_l_e   _f_i_l_e is a directory
        !          2486:      _f_i_l_e_1 -eeff _f_i_l_e_2
        !          2487:                Files are identical (kksshh)
        !          2488:      _n_1 -eeqq _n_2 Numbers are equal
        !          2489:      -ff _f_i_l_e   _f_i_l_e exists and is not a directory
        !          2490:      -gg _f_i_l_e   _f_i_l_e has sseettggiidd bit set (kksshh)
        !          2491:      _n_1 -ggee _n_2 _n_1 is greater than or equal to _n_2
        !          2492:      _n_1 -ggtt _n_2 _n_1 greater than _n_2
        !          2493:      -kk _f_i_l_e   _f_i_l_e has sticky bit set (kksshh)
        !          2494:      -LL _f_i_l_e   _f_i_l_e is a symbolic link (kksshh)
        !          2495:      _n_1 -llee _n_2 _n_1 is less than or equal to _n_2
        !          2496:      _n_1 -lltt _n_2 _n_1 is less than _n_2
        !          2497:      -nn _s_t_r_i_n_g ssttrriinngg has non-zero length
        !          2498:      _n_1 -nnee _n_2 _n_1 does not equal _n_2
        !          2499:      _f_1 -nntt _f_2 _f_1 is newer than _f_2 (kksshh)
        !          2500:      _e_x_p_1 -oo _e_x_p_2
        !          2501:                Either _e_x_p_1 or _e_x_p_2 is true
        !          2502:      _f_1 -oott _f_2 _f_1 is older than _f_2 (kksshh)
        !          2503:      -pp _f_i_l_e   _f_i_l_e is a named pipe (kksshh)
        !          2504:      -rr _f_i_l_e   _f_i_l_e is readable
        !          2505:      -ss _f_i_l_e   _f_i_l_e exists and has nonzero length
        !          2506:      -tt [_f_d]   _f_d describes a terminal
        !          2507:      -uu _f_i_l_e   _f_i_l_e has sseettuuiidd set (kksshh)
        !          2508:      -ww _f_i_l_e   _f_i_l_e is writable
        !          2509:      -xx _f_i_l_e   _f_i_l_e is executable (kksshh)
        !          2510:      -zz _s_t_r_i_n_g _s_t_r_i_n_g has zero length
        !          2511:      _s_t_r_i_n_g    _s_t_r_i_n_g has non-zero length
        !          2512:      _s_1 = _s_2   _s_1 equals string _s_2
        !          2513:      ! _e_x_p     Negate logical value of _e_x_p
        !          2514:      _s_1 != _s_2  String _s_1 does not equal _s_2
        !          2515:      (_e_x_p)     Parentheses group expressions
        !          2516: #tic
        !          2517: ttiicc -- Compile a terminfo description
        !          2518: 
        !          2519: ttiicc [-vv[_n]] _s_o_u_r_c_e_f_i_l_e
        !          2520: 
        !          2521: _O_p_t_i_o_n:
        !          2522:      -vv        Verbose: Include debugging and tracing information.
        !          2523: #time
        !          2524: ttiimmee -- Time the execution of a command
        !          2525: 
        !          2526: ttiimmee [_c_o_m_m_a_n_d]
        !          2527: 
        !          2528: #times
        !          2529: ttiimmeess -- Print total user and system times
        !          2530: 
        !          2531: ttiimmeess
        !          2532: 
        !          2533: #touch
        !          2534: ttoouucchh -- Update modification time of a file
        !          2535: 
        !          2536: ttoouucchh [ -cc ] _f_i_l_e ...
        !          2537: 
        !          2538: _O_p_t_i_o_n:
        !          2539:      -cc        Do not create _f_i_l_e if it does not exist
        !          2540: 
        !          2541: The shell executes ttoouucchh directly.
        !          2542: #tr
        !          2543: ttrr -- Translate characters
        !          2544: 
        !          2545: ttrr [-ccddss] _s_t_r_i_n_g_1 [_s_t_r_i_n_g_2]
        !          2546: 
        !          2547: _O_p_t_i_o_n_s:
        !          2548:      -cc        Complement the characters in _s_t_r_i_n_g_1
        !          2549:      -dd        Delete characters found in _s_t_r_i_n_g_1 (_n_o _s_t_r_i_n_g_2 needed)
        !          2550:      -ss        Squeeze multiple output mappings onto one character
        !          2551: 
        !          2552: Both strings may contain ranges.  Characters may have form \_n_n_n.
        !          2553: #trap
        !          2554: ttrraapp -- Execute command on receipt of signal
        !          2555: 
        !          2556: ttrraapp [_c_o_m_m_a_n_d] [_n ...]
        !          2557: 
        !          2558: The shell executes _c_o_m_m_a_n_d on receipt of signal _n ....  If _c_o_m_m_a_n_d omitted, the
        !          2559: shell resets traps on given signals to original values.  If _c_o_m_m_a_n_d is a null
        !          2560: string, given signals are ignored.  If _n is zero, the shell executes _c_o_m_m_a_n_d
        !          2561: when it exits.  With no arguments, it prints currently set traps.  The shell
        !          2562: executes trap directly.
        !          2563: #troff
        !          2564: ttrrooffff -- Extended text-formatting language
        !          2565: 
        !          2566: ttrrooffff [_o_p_t_i_o_n ...] [_f_i_l_e ...]
        !          2567: 
        !          2568: _O_p_t_i_o_n_s:
        !          2569:      -DD        Display available fonts
        !          2570:      -ff _n_a_m_e   Write temporary file in file _n_a_m_e
        !          2571:      -ii        Read stdin after each _f_i_l_e has been read
        !          2572:      -kk        Keep temporary file
        !          2573:      -ll        Landscape mode
        !          2574:      -mm_n_a_m_e    Read macro package /uussrr/lliibb/ttmmaacc._n_a_m_e
        !          2575:      -nn_N       Number first page of output _N (default, one)
        !          2576:      -pp        Produce PostScript output
        !          2577:      -rr_a_N      Set number register _a to value _N
        !          2578:      -rr_a_b_N     Set number register _a_b to value _N; for obvious reasons, _a_b
        !          2579:                cannot contain a digit
        !          2580:      -xx        Do not eject to bottom of final page
        !          2581: #true
        !          2582: ttrruuee -- Unconditional success
        !          2583: 
        !          2584: ttrruuee
        !          2585: 
        !          2586: #tsort
        !          2587: ttssoorrtt -- Topological sort
        !          2588: 
        !          2589: ttssoorrtt [_f_i_l_e]
        !          2590: 
        !          2591: #ttt
        !          2592: tttttt -- Play 3-D tic-tac-toe
        !          2593: 
        !          2594: /uussrr/ggaammeess/tttttt
        !          2595: 
        !          2596: #tty
        !          2597: ttttyy -- Print the user's terminal name
        !          2598: 
        !          2599: ttttyy
        !          2600: 
        !          2601: #ttystat
        !          2602: ttttyyssttaatt -- Get terminal status
        !          2603: 
        !          2604: /eettcc/ttttyyssttaatt [ -dd ] _p_o_r_t
        !          2605: 
        !          2606: _O_p_t_i_o_n:
        !          2607:      -dd        Print status of _p_o_r_t
        !          2608: 
        !          2609: Returns exit status 1 if specified port is enabled, 0 if disabled.  Prints
        !          2610: nothing unless -dd option specified.
        !          2611: #typeset
        !          2612: ttyyppeesseett -- Set/list variables and their attributes
        !          2613: 
        !          2614: ttyyppeesseett
        !          2615: ttyyppeesseett [+-]ffrr
        !          2616: ttyyppeesseett [ iirrxx ] _v_a_r_i_a_b_l_e=_v_a_l_u_e
        !          2617: 
        !          2618: 
        !          2619: _F_i_r_s_t _f_o_r_m: List all variables and their attributes
        !          2620: _S_e_c_o_n_d _f_o_r_m:
        !          2621:      +ff        List functions
        !          2622:      -ff        List functions plus values
        !          2623:      +rr        List read-only variables
        !          2624:      -rr        List read-only variables plus values
        !          2625: 
        !          2626: _T_h_i_r_d _f_o_r_m: Set _v_a_r_i_a_b_l_e to equal _v_a_l_u_e
        !          2627:      ii         Store _v_a_l_u_e as an integer
        !          2628:      rr         List read-only variables
        !          2629:      xx         Export _v_a_r_i_a_b_l_e=_f_R _t_o _e_n_v_i_r_o_n_m_e_n_t
        !          2630: 
        !          2631: kksshh only.
        !          2632: #typo
        !          2633: ttyyppoo -- Detect possible typographical and spelling errors
        !          2634: 
        !          2635: ttyyppoo [-nnrrss][_f_i_l_e ...]
        !          2636: 
        !          2637: _O_p_t_i_o_n_s:
        !          2638:      -nn        Do not use built-in English statistics or dictionary
        !          2639:      -rr        Raw; do not remove nroff commands from the input
        !          2640:      -ss        Produce _d_i_g_r_a_m_s and _t_r_i_g_r_a_m_s files (maintenance only)
        !          2641: #umask
        !          2642: uummaasskk -- Set the file-creation mask
        !          2643: 
        !          2644: uummaasskk [_m_a_s_k]
        !          2645: 
        !          2646: The shell executes uummaasskk directly.
        !          2647: #umount
        !          2648: uummoouunntt -- Unmount file system
        !          2649: 
        !          2650: /eettcc/uummoouunntt _s_p_e_c_i_a_l
        !          2651: 
        !          2652: #unalias
        !          2653: uunnaalliiaass -- Remove an alias
        !          2654: 
        !          2655: uunnaalliiaass _a_l_i_a_s ...
        !          2656: kksshh only.  kksshh only.
        !          2657: 
        !          2658: #uncompress
        !          2659: uunnccoommpprreessss -- Uncompress a compressed file
        !          2660: 
        !          2661: uunnccoommpprreessss [ -ww _t_m_p_f_i_l_e ] [ _f_i_l_e ... ] (COHERENT 286)
        !          2662: uunnccoommpprreessss [ _f_i_l_e ... ] (COHERENT 386)
        !          2663: 
        !          2664: _O_p_t_i_o_n:
        !          2665:      -ww        Use _t_m_p_f_i_l_e as the workfile (default, /ddeevv/rraamm11) COHERENT 286
        !          2666:                only.
        !          2667: #uniq
        !          2668: uunniiqq -- Remove/count repeated lines in a sorted file
        !          2669: 
        !          2670: uunniiqq [-ccdduu] [-_n] [+_n] [_i_n_f_i_l_e[_o_u_t_f_i_l_e]]
        !          2671: 
        !          2672: _O_p_t_i_o_n_s:
        !          2673:      -cc        Print duplication count with lines
        !          2674:      -dd        Print only duplicated lines
        !          2675:      -nn        Skip _n fields during comparison
        !          2676:      +nn        Skip _n characters (after skipping fields)
        !          2677:      -uu        Print only non-repeated lines
        !          2678: #units
        !          2679: uunniittss -- Convert measurements
        !          2680: 
        !          2681: uunniittss [ -uu ]
        !          2682: 
        !          2683: _O_p_t_i_o_n:
        !          2684:      -uu        Update binary file only
        !          2685: 
        !          2686: uunniittss works interactively.
        !          2687: #unmkfs
        !          2688: uunnmmkkffss -- Construct a prototype file system
        !          2689: 
        !          2690: uunnmmkkffss [-_p_r_e_f_i_x] _d_i_r_e_c_t_o_r_y _n_b_l_o_c_k_s [_f_i_l_e]
        !          2691: 
        !          2692: #until
        !          2693: uunnttiill -- Execute commands repeatedly
        !          2694: 
        !          2695: uunnttiill _s_e_q_u_e_n_c_e_1 [ ddoo _s_e_q_u_e_n_c_e_2 ] ddoonnee
        !          2696: 
        !          2697: Both ddoo and ddoonnee must be the first token on a line or preceded by `;'.  The
        !          2698: shell executes uunnttiill directly.
        !          2699: #update
        !          2700: uuppddaattee -- Update file systems periodically
        !          2701: 
        !          2702: /eettcc/uuppddaattee
        !          2703: 
        !          2704: update -- Update file systems periodically Usage:       /etc/update
        !          2705: #ustar
        !          2706: uussttaarr -- Process tape archives
        !          2707: 
        !          2708: uussttaarr -cc[vvww] [-ff _a_r_c_h_i_v_e] _f_i_l_e ...
        !          2709: uussttaarr -rr[vvww] [-ff _a_r_c_h_i_v_e] _f_i_l_e ...
        !          2710: uussttaarr -tt[vv] [-ff _a_r_c_h_i_v_e]
        !          2711: uussttaarr -xx[llmmoovvww] [-ff _a_r_c_h_i_v_e] [_f_i_l_e ...]
        !          2712: 
        !          2713: _O_p_t_i_o_n_s:
        !          2714:      -cc        Create a new archive
        !          2715:      -rr        Append _f_i_l_e into _a_r_c_h_i_v_e
        !          2716:      -tt        Print table of contents for _a_r_c_h_i_v_e
        !          2717:      -xx        Extract _f_i_l_e from _a_r_c_h_i_v_e
        !          2718: _M_o_d_i_f_i_e_r_s:
        !          2719:      -ff        Next argument names output archive
        !          2720:      -ll        Print error message if all links cannot be resolved (cc or rr
        !          2721:                commands only)
        !          2722:      -mm        Do not restore modification time (invalid with tt)
        !          2723:      -oo        Give extracted files your user and group identifiers (xx command
        !          2724:                only)
        !          2725:      -vv        Verbose option
        !          2726:      -ww        Wait option: wait for confirmation before continuing
        !          2727: #uucheck
        !          2728: uuuucchheecckk -- Sanity-check the UUCP system
        !          2729: 
        !          2730: uuuucchheecckk [ -ffssvv ]
        !          2731: 
        !          2732: _O_p_t_i_o_n_s:
        !          2733:      -ff        Attempt to ``fix'' any problems found
        !          2734:      -ss        Run in ``silent'' mode, generating no output
        !          2735:      -vv        Run in ``verbose'' mode, generating extra output
        !          2736: #uucico
        !          2737: uuuucciiccoo -- Transmit data to or from a remote site
        !          2738: 
        !          2739: /uussrr/lliibb/uuuuccpp/uuuucciiccoo [ -cc_s_i_t_e ] [ -rr11 ] [ -ss_s_i_t_e ] [ -ssaallll ] [ -SS_s_i_t_e ] [ -xx_l_e_v_e_l ]
        !          2740: 
        !          2741: _O_p_t_i_o_n_s:
        !          2742:      -cc_s_i_t_e    Poll _s_i_t_e only if a file is queued for transmission to it
        !          2743:      -rr00       Act as slave in polling process
        !          2744:      -rr11       Act as master in polling process; default
        !          2745:      -ss_s_i_t_e    Name _s_i_t_e as a place to be polled
        !          2746:      -ssaallll     Poll all sites automatically
        !          2747:      -SS_s_i_t_e    Poll _s_i_t_e unconditionally
        !          2748:      -xx_l_e_v_e_l   Run in debug mode; _l_e_v_e_l sets level of debugging, from 1 to 10
        !          2749: #uucp
        !          2750: uuuuccpp -- Ready files for transmission to other systems
        !          2751: 
        !          2752: uuuuccpp [ -ccCCddffmmrr ] [-nn_u_s_e_r] [-ss _d_i_r] [-xx_n] _s_o_u_r_c_e ... _d_e_s_t
        !          2753: 
        !          2754: _O_p_t_i_o_n_s:
        !          2755:      -cc        Do not copy source to spool directory; rather use the file
        !          2756:                itself (default)
        !          2757:      -CC        Copy source file to spool directory
        !          2758:      -dd        Create directories as required on destination
        !          2759:      -ff        Do not make intermediate directories.
        !          2760:      -mm        Send mail to requester when file is sent
        !          2761:      -nn_u_s_e_r    Notify _u_s_e_r (on destination system) when file received
        !          2762:      -rr        Spool transfer request, do not initiate uuuucciiccoo
        !          2763:      -xx_l_e_v_e_l   Assign debug _l_e_v_e_l (0 to 9)
        !          2764: #uucpname
        !          2765: uuuuccppnnaammee -- Set the system's UUCP name
        !          2766: 
        !          2767: /eettcc/uuuuccppnnaammee
        !          2768: 
        !          2769: #uudecode
        !          2770: uuuuddeeccooddee -- Decode a binary file sent from a remote system
        !          2771: 
        !          2772: uuuuddeeccooddee [ _f_i_l_e ]
        !          2773: 
        !          2774: #uuencode
        !          2775: uuuueennccooddee -- Encode a binary file for transmission
        !          2776: 
        !          2777: uuuueennccooddee [ _s_o_u_r_c_e ] _r_e_m_o_t_e_d_e_s_t
        !          2778: 
        !          2779: #uuinstall
        !          2780: uuuuiinnssttaallll -- Install UUCP
        !          2781: 
        !          2782: uuuuiinnssttaallll
        !          2783: 
        !          2784: #uulog
        !          2785: uuuulloogg -- Examine UUCP operations
        !          2786: 
        !          2787: uuuulloogg [ -ffxx ] [ _s_y_s_t_e_m ]
        !          2788: 
        !          2789: _O_p_t_i_o_n_s:
        !          2790:      -ff        Show UUCP activity as it is logged; like ttaaiill -ff
        !          2791:      -xx        Display logs for uuuuxxqqtt instead of uuuucciiccoo
        !          2792: #uumvlog
        !          2793: uuuummvvlloogg -- Archive UUCP log files
        !          2794: 
        !          2795: uuuummvvlloogg _d_a_y_s
        !          2796: 
        !          2797: _O_p_t_i_o_n_s:
        !          2798:      _d_a_y_s      Number of days for which logs should be kept
        !          2799: #uuname
        !          2800: uuuunnaammee -- List UUCP names of known systems
        !          2801: 
        !          2802: uuuunnaammee [ -ll ]
        !          2803: 
        !          2804: _O_p_t_i_o_n:
        !          2805:      -ll        Print name of the local system
        !          2806: #uurmlock
        !          2807: uuuurrmmlloocckk -- Remove UUCP lock files
        !          2808: 
        !          2809: uuuurrmmlloocckk
        !          2810: 
        !          2811: #uutouch
        !          2812: uuuuttoouucchh -- Touch a file to trigger uucico poll
        !          2813: 
        !          2814: uuuuttoouucchh _s_y_s_t_e_m
        !          2815: 
        !          2816: #uux
        !          2817: uuuuxx -- Execute a command on a remote system
        !          2818: 
        !          2819: uuuuxx [-aa _u_s_e_r] [-rrnnppzz] _c_o_m_m_a_n_d-_s_t_r_i_n_g
        !          2820: 
        !          2821: _O_p_t_i_o_n_s:
        !          2822:      -aa _u_s_e_r   Name _u_s_e_r as requester
        !          2823:      -gg _l      Set importance of transmission; _l is a single ASCII character
        !          2824:      -nn        Suppress notification of command completion
        !          2825:      -pp        Input to uuuuxx is a pipe or input redirection
        !          2826:      -rr        Queue uuuuxx request; do not invoke uuuucciiccoo
        !          2827:      -zz        Notify requestor when _c_o_m_m_a_n_d-_l_i_n_e succeeds
        !          2828: #uuxqt
        !          2829: uuuuxxqqtt -- Execute commands requested by a remote system
        !          2830: 
        !          2831: uuuuxxqqtt
        !          2832: 
        !          2833: #vi
        !          2834: vvii -- Clone of Berkeley-style screen editor
        !          2835: 
        !          2836: vvii [ _o_p_t_i_o_n_s ] [ +_c_m_d ] [ _f_i_l_e_1 ... _f_i_l_e_2_7 ]
        !          2837: 
        !          2838: _O_p_t_i_o_n_s:
        !          2839:      -ee        Begin in colon-command mode
        !          2840:      -ii        Begin in input mode
        !          2841:      -rr        Recover a previous edit
        !          2842:      -RR        Read-only mode
        !          2843:      -tt _t_a_g    Begin editing at _t_a_g
        !          2844:      -mm        Use in error-handling mode
        !          2845:      -vv        Begin in visual-command mode
        !          2846:      +_c_o_m_m_a_n_d  Execute _c_o_m_m_a_n_d before editing
        !          2847: #view
        !          2848: vviieeww -- Screen-oriented viewing utility
        !          2849: 
        !          2850: vviieeww _f_i_l_e_1 ... _f_i_l_e_2_7
        !          2851: 
        !          2852: #virec
        !          2853: vviirreecc -- Recover the modified version of a file after a crash
        !          2854: 
        !          2855: vviirreecc [-dd _t_m_p_d_i_r] _t_e_x_t_f_i_l_e_n_a_m_e...
        !          2856: vviirreecc </ttmmpp/eellvv_X_X_X
        !          2857: 
        !          2858: #wait
        !          2859: wwaaiitt -- Await completion of background process
        !          2860: 
        !          2861: wwaaiitt [_p_i_d]
        !          2862: 
        !          2863: _p_i_d identifies the process whose completion is awaited.  If no _p_i_d is given,
        !          2864: wwaaiitt awaits completion of all background processes.  The shell executes wwaaiitt
        !          2865: directly.
        !          2866: #wall
        !          2867: wwaallll -- Send a message to all logged-in users
        !          2868: 
        !          2869: /eettcc/wwaallll
        !          2870: 
        !          2871: #wc
        !          2872: wwcc -- Count words, lines, and characters in text files
        !          2873: 
        !          2874: wwcc [-ccllww] [_f_i_l_e...]
        !          2875: 
        !          2876: _O_p_t_i_o_n_s:
        !          2877:      -cc        Print count of characters
        !          2878:      -ll        Print count of lines
        !          2879:      -ww        Print count of words
        !          2880: 
        !          2881: If no _f_i_l_e is given, wwcc reads stdin; if more than one _f_i_l_e is given, it also
        !          2882: prints a total.
        !          2883: #whence
        !          2884: wwhheennccee -- List a command's type
        !          2885: 
        !          2886: wwhheennccee [-vv] _c_o_m_m_a_n_d ...
        !          2887: 
        !          2888: kksshh only.
        !          2889: #whereis
        !          2890: wwhheerreeiiss -- Locate source, binary, and manual files
        !          2891: 
        !          2892: wwhheerreeiiss [-bbmmrrssuu] [-BBMMSS _d_i_r ... -ff] _n_a_m_e ...
        !          2893: 
        !          2894: _O_p_t_i_o_n_s:
        !          2895:      -bb        Search only for for binary files
        !          2896:      -mm        Search only for manual pages
        !          2897:      -rr        Search each _d_i_r downwardly recursively
        !          2898:      -ss        Search only for source files
        !          2899:      -uu        Search for unusual files
        !          2900:      -BB        Search each _d_i_r for binary files
        !          2901:      -MM        Search each _d_i_r for manual pages
        !          2902:      -RR        Search each _d_i_r downwardly recursively
        !          2903:      -SS        Search each _d_i_r for source files
        !          2904:      -ff        Terminate directory list begun by -BBMMRRSS options
        !          2905: #which
        !          2906: wwhhiicchh -- Locate executable files
        !          2907: 
        !          2908: wwhhiicchh _c_o_m_m_a_n_d ...
        !          2909: 
        !          2910: #while
        !          2911: wwhhiillee -- Execute commands repeatedly
        !          2912: 
        !          2913: wwhhiillee _s_e_q_u_e_n_c_e_1 [ddoo _s_e_q_u_e_n_c_e_2] ddoonnee
        !          2914: 
        !          2915: Both ddoo and ddoonnee must be the first token on a line or preceded by `;'.  The
        !          2916: shell executes wwhhiillee directly.
        !          2917: #who
        !          2918: wwhhoo -- Print who is logged in
        !          2919: 
        !          2920: wwhhoo [_f_i_l_e] [aamm ii]
        !          2921: 
        !          2922: #write
        !          2923: wwrriittee -- Converse with another user
        !          2924: 
        !          2925: wwrriittee _u_s_e_r [ _t_t_y ]
        !          2926: 
        !          2927: Name the _t_t_y if _u_s_e_r is logged in on more than one port.
        !          2928: #yacc
        !          2929: yyaacccc -- Parser generator
        !          2930: 
        !          2931: yyaacccc [_o_p_t_i_o_n ...] _f_i_l_e
        !          2932: cccc yy.ttaabb.cc [-llyy]
        !          2933: 
        !          2934: _O_p_t_i_o_n_s:
        !          2935:      -dd        Enable debugging output (implies -vv)
        !          2936:      -hhddrr      Next argument is name of header file (default, yy.ttaabb.hh)
        !          2937:      -iitteemmss    AAllllooww _N items per state.
        !          2938:      -ll        Next argument is name of listfile (default, yy.oouuttppuutt)
        !          2939:      sspprroodd _N   Allow _N symbols per production (default, 20)
        !          2940:      -sstt       Print statistics on standard output
        !          2941:      -vv        Verbose (extra output in listfile)
        !          2942: 
        !          2943: After each of the following, the next argument is a number to reset table size:
        !          2944:      -nntteerrmmss   Nonterminal symbols (default, 100)
        !          2945:      -pprrooddss    Productions or rules (default, 350)
        !          2946:      -ssttaatteess   States (default, 300)
        !          2947:      -tteerrmmss    Terminal symbols (default, 300)
        !          2948:      -ttyyppeess    Types (default, 10)
        !          2949: #yes
        !          2950: yyeess -- Print infinitely many responses
        !          2951: 
        !          2952: yyeess [ _s_t_r_i_n_g ]
        !          2953: 
        !          2954: #zcat
        !          2955: zzccaatt -- Concatenate a compressed file
        !          2956: 
        !          2957: zzccaatt [-ww _t_m_p_f_i_l_e ] [ _f_i_l_e ... ] (COHERENT 286)
        !          2958: zzccaatt [ _f_i_l_e ... ] (COHERENT 386)
        !          2959: 
        !          2960:      -ww _t_m_p_f_i_l_e
        !          2961:                Use _t_m_p_f_i_l_e as the workfile (default, /ddeevv/rraamm11).  COHERENT 286
        !          2962:                only.

This archive runs on limited infrastructure. Preserving old code on modern bandwidth. Automated agents are requested to crawl responsibly.