|
|
coherent
#ac
aacc -- Summarize login accounting information
aacc [ -ddpp ] [ -ww _w_f_i_l_e ][ _u_s_e_r_n_a_m_e ... ]
_O_p_t_i_o_n_s:
-dd Itemize for each midnight-midnight period
-pp Itemize by individual users
-ww _w_t_m_p Obtain raw statistics from _w_t_m_p rather than /uussrr/aaddmm/wwttmmpp
If users are specified, only they are considered.
#accton
aaccccttoonn -- Enable/disable process accounting
/eettcc/aaccccttoonn [ _f_i_l_e ]
Normally _f_i_l_e is /uussrr/aaddmm/aacccctt. If no _f_i_l_e argument is included, disable
process accounting.
#alias
aalliiaass -- Set an alias
aalliiaass [_n_a_m_e[=_v_a_l_u_e ...]]
kksshh only.
#aliases
aalliiaasseess -- File of users' aliases
/uussrr/lliibb/mmaaiill/aalliiaasseess
$HHOOMMEE/.aalliiaasseess
$HHOOMMEE/.ffoorrwwaarrdd
#ar
aarr -- The librarian/archiver
aarr _o_p_t_i_o_n [_m_o_d_i_f_i_e_r][_p_o_s_i_t_i_o_n] _a_r_c_h_i_v_e [_m_e_m_b_e_r ...]
_O_p_t_i_o_n_s:
dd Delete given members
mm Move member to indicated position (default, end)
pp Print members
qq Quick append, put members at end with no checking
rr Replace each member specified in the archive
tt Print a table of members (default, all)
xx Extract the specified members (default, all)
_M_o_d_i_f_i_e_r_s:
aa Place new member after _p_o_s_i_t_i_o_n in archive
bb Place new member before _p_o_s_i_t_i_o_n in archive
cc Suppress message when new archive is created
ii Insert new member before _p_o_s_i_t_i_o_n in archive
kk Preserve modify time of file (with options rr, qq, or xx)
ll Use current directory for temporaries (default, /ttmmpp)
ss Update ranlib header even if not present (with options rr or mm)
uu Update: replace members only if newer than those in archive
vv Print extra information when used with certain options
#as 286
aass 228866 -- i80286 assembler
aass [-ggllxx] [ -oo_f_i_l_e ] _f_i_l_e ...
_O_p_t_i_o_n_s:
-gg Make all undefined symbols global
-ll Output listing to standard output
-oo _d_e_s_t Rename output file _d_e_s_t (default, ll.oouutt)
-xx Strip local symbols from symbol table
#as 386
aass 338866 -- i80386 assembler
aass [-oo _o_u_t_f_i_l_e] [-bbffggllnnppwwxxXX] _i_n_f_i_l_e
_O_p_t_i_o_n_s:
-bb Reverse bracket sense; that is, use () for expressions and []
for code.
-ff Reverse order of operands from UNIX assembler form to that of
Intel documentation or 80286 version of aass.
-gg Make undefined symbols .gglloobbll.
-ll Generate output listing.
-nn Turn off the insertion of nnoopps to correct 80386 errors.
-oo _o_u_t_f_i_l_e
Name the file into which the relocatable object is written
-pp Don't use `%' on register names; e.g., use aaxx, not %aaxx.
-QQ Quiet: Suppress all error messages, no matter how awful an error
they indicate
-ww Disable warning messages.
-xx Remove all non-global symbols from the common symbol output.
-XX Remove all non-global symbols starting with .LL from the common
symbol output.
Options and file names can be interspersed on the command line.
The 80386 version of aass assembles files written in the 80286 dialect of aass or
UNIX-style assembly language. It generates relocatable object modules that can
be linked with objects compiled by the COHERENT C compiler. It also contains a
number of features not available with the 80286 dialect of aass, including macro
assembly.
#asfix
aassffiixx -- Convert assembly-language programs into as 80386 format
aassffiixx < _o_l_d_f_i_l_e > _n_e_w_f_i_l_e
#at
aatt -- Execute commands at given time
aatt [ -vv ] [ -cc _c_o_m_m_a_n_d ] _t_i_m_e [ [ _d_a_y ] _w_e_e_k ] [ _f_i_l_e ]
aatt [ -vv ] [ -cc _c_o_m_m_a_n_d ] _t_i_m_e _m_o_n_t_h _d_a_y [ _f_i_l_e ]
_O_p_t_i_o_n_s:
-cc Following argument gives command
-vv Print time for which command is set
If _f_i_l_e is given, read commands from it. If neither _f_i_l_e nor -cc is given, read
commands from stdin.
#ATclock
AATTcclloocckk -- Read or set the AT realtime clock
/eettcc/AATTcclloocckk [_y_y[_m_m[_d_d[_h_h[_m_m[._s_s]]]]]]
With an argument, AATTcclloocckk sets your computer's realtime clock. With no
argument, it reads it.
#atrun
aattrruunn -- Execute commands at a preset time
#awk
aawwkk -- Pattern-scanning language
aawwkk [-yy][-FF_c][-ff _p_r_o_g_f_i_l_e][_p_r_o_g][_f_i_l_e ...]
_O_p_t_i_o_n_s:
-FF_c Set field separator character to _c (default, blank, and tab)
-ff _p_r_o_g_f_i_l_e is the aawwkk program; otherwise, first non-option
argument is aawwkk program
-yy Dual case match (as in ggrreepp)
If no _f_i_l_e is present, the stdin is used. File `-' means stdin.
#bad
bbaadd -- Maintain list of bad blocks
bbaadd _o_p_t_i_o_n _f_i_l_e_s_y_s_t_e_m [ block ... ]
_O_p_t_i_o_n_s:
aa Add blocks
cc Clear bad-block list
dd Delete blocks
ll List blocks
#badscan
bbaaddssccaann -- Build bad block list
/eettcc/bbaaddssccaann [ -vv ] [ -oo _p_r_o_t_o ] [ -bb _b_o_o_t ] _d_e_v_i_c_e _s_i_z_e
/eettcc/bbaaddssccaann [ -vv ] [ -oo _p_r_o_t_o ] [ -bb _b_o_o_t ] _d_e_v_i_c_e _x_d_e_v_i_c_e
_O_p_t_i_o_n_s:
-bb _b_o_o_t Insert bootstrap _b_o_o_t into _p_r_o_t_o
-oo _p_r_o_t_o Write prototype into file _p_r_o_t_o
-vv Print estimate of time remaining
Scan _d_e_v_i_c_e of _s_i_z_e bytes (or size given in hard disk partition table _x_d_e_v_i_c_e)
for bad blocks, write prototype to stdout.
#banner
bbaannnneerr -- Print large letters
bbaannnneerr [ _a_r_g_u_m_e_n_t ... ]
Print each _a_r_g_u_m_e_n_t as one line of large-text output. If no arguments, print
each line from stdin as a line of large output.
#basename
bbaasseennaammee -- Strip path information from a file name
bbaasseennaammee _f_i_l_e [ _s_u_f_f_i_x ]
#bc
bbcc -- Interactive calculator with arbitrary precision
bbcc [ -ll ] [ _f_i_l_e ... ]
_O_p_t_i_o_n:
-ll Use the extended bbcc library
If no _f_i_l_e is specified, bbcc reads stdin.
#bind
bbiinndd -- Bind key sequence to editing command
bbiinndd [-mm] [_s_t_r_i_n_g [= _c_o_m_m_a_n_d]]
_O_p_t_i_o_n:
-mm Bind multiple commands to one keystroke
With no arguments, bbiinndd displays all current bindings. kksshh only.
#boottime
bboooottttiimmee -- File that holds time system was last booted
#brc
bbrrcc -- Perform maintenance chores, single-user mode
/eettcc/bbrrcc
#break
bbrreeaakk -- Exit from shell construct
bbrreeaakk [ _n ]
Exit from _n (default, one) ffoorr, uunnttiill, or wwhhiillee constructs. The shell executes
bbrreeaakk directly.
#build
bbuuiilldd -- Install COHERENT onto a hard disk
/eettcc/bbuuiilldd
#builtin
bbuuiillttiinn -- Execute a command as a built-in command
bbuuiillttiinn _c_o_m_m_a_n_d [ _a_r_g ... ]
kksshh only.
#c
cc -- Print multi-column output
cc [ -ll_N ] [ -ww_N ] [ -001122 ]
_O_p_t_i_o_n_s:
-ll_N Set the page length to _N lines
-ww_N Set the page width to _N columns
-00 Order fields horizontally across the page
-11 Order fields vertically down each column (default)
-22 Special case of -1
#cal
ccaall -- Print a calendar
ccaall [ _m_o_n_t_h ] [ _y_e_a_r ]
#calendar
ccaalleennddaarr -- Reminder service
ccaalleennddaarr [ -aa ] [ -ff_f_i_l_e ]... [ -dd[_d_a_t_e] ] [ -ww[_d_a_t_e] ] [ -mm[_m_o_n_t_h] ]
_O_p_t_i_o_n_s:
-aa Search calendars of all users and send mail
-ff_f_i_l_e Search each _f_i_l_e in order given
-dd[_d_a_t_e] Print all entries matching _d_a_t_e
-ww[_d_a_t_e] Print entries in the week beginning with _d_a_t_e
-mm[_m_o_n_t_h] Print entries in the given _m_o_n_t_h
The default calendar is $HHOOMMEE/.ccaalleennddaarr. The default date is today.
#captoinfo
ccaappttooiinnffoo -- Convert termcap data to terminfo form
ccaappttooiinnffoo [_f_i_l_e_n_a_m_e]
#case
ccaassee -- Execute commands conditionally according to pattern
ccaassee _t_o_k_e_n iinn [_p_a_t_t_e_r_n [|_p_a_t_t_e_r_n] ...) _s_e_q_u_e_n_c_e ;;] ... eessaacc
The shell executes ccaassee directly.
#cat
ccaatt -- Concatenate/print files
ccaatt [ -uu ][ _f_i_l_e ... ]
_O_p_t_i_o_n:
-uu Do not buffer output in 512-byte blocks
File `-' indicates the standard input. If no _f_i_l_e is specified, ccaatt reads
stdin.
#cc
cccc -- C compiler
cccc [_c_o_m_p_i_l_e_r _o_p_t_i_o_n_s] _f_i_l_e .... [_l_i_n_k_e_r _o_p_t_i_o_n_s]
_O_p_t_i_o_n_s:
-BB[ssttrr] Use backup compiler versions.
-cc Compile only -- no load
-DD_n_a_m_e[=_v_a_l_u_e]
Tell ccpppp to define _n_a_m_e with _v_a_l_u_e
-EE Run ccpppp only and send its output to stdout
-ff Include floating point output routines in load
-IInnaammee Tell ccpppp to look for header files in directory _n_a_m_e
-KK Keep intermediate files
-LL_d_i_r_e_c_t_o_r_y
Tell the linker lldd to search ddiirreeccttoorryy for its libraries before
it searches the directories named in the environmental variable
LLIIBBPPAATTHH
-ll_n_a_m_e Pass /lliibb/lliibb_n_a_m_e.aa to linker lldd
-MM_s_t_r Use alternative machine versions
-NN[pp0011aabb22ssddllrrtt]_s_t_r
Rename specified pass to _s_t_r
-OO Run peephole optimizer of C compiler
-qq[pp0011aabb22ss]
Quit after specified pass
-QQ Quiet: suppress all error messages, no matter how awful an error
they indicate
-SS Place C compiler assembler output in a .ss file
-TT_s_i_z_e Tell cccc to use buffers of _s_i_z_e_n bytes each, instead of its
default 64-kilobytes buffers (COHERENT 386 only)
-tt[pp0011aabb22ssddllrrtt]
Take specified compiler phases.
-UU_n_a_m_e Tell ccpppp to remove any initial definition of _n_a_m_e
-VV Run verbosely
-VV_n_a_m_e Toggle variant VV_n_a_m_e
Compiles files ending .cc; assembles files ending in .ss; passes other options
and files to the linker lldd.
#cd
ccdd -- Change directory
ccdd _d_i_r_e_c_t_o_r_y
If no _d_i_r_e_c_t_o_r_y specified, $HHOOMMEE is assumed. The shell executes ccdd directly.
#cdmp
ccddmmpp -- Dump COFF files into a readable form
ccddmmpp [-aaddllrrss] _f_i_l_e_n_a_m_e
_O_p_t_i_o_n_s:
-aa Suppress auxiliary symbol entries
-dd Suppress data dumps
-ll Suppress line numbers
-rr Suppress relocation entries
-ss Suppress symbol entries
#cgrep
ccggrreepp -- Pattern search for C source programs
ccggrreepp [-ccllnnssAA] [-rr _n_e_w] _e_x_p_r_e_s_s_i_o_n _f_i_l_e ...
_O_p_t_i_o_n_s:
-AA Build _e_r_r_o_r _l_i_s_t for interactive editing using MicroEMACS, like
-AA option to the cccc command.
-cc Print all C comments
-ll Return file where _e_x_p_r_e_s_s_i_o_n found
-nn Prefix each line containing _e_x_p_r_e_s_s_i_o_n_s with its number in its
source file
-rr Replaces each _e_x_p_r_e_s_s_i_o_n with _n_e_w
-ss Print all C strings
#chase
cchhaassee -- Highly amusing video game
/uussrr/ggaammeess/cchhaassee [ -cc ] [ _s_p_e_e_d ]
_O_p_t_i_o_n_s:
-cc Color video card
_s_p_e_e_d Speed of game: the lower the number, the faster the speed
(default, 10)
#check
cchheecckk -- Check file system
cchheecckk [-ss] _f_i_l_e_s_y_s_t_e_m ...
_O_p_t_i_o_n:
-ss Salvage as much as possible, given the problems detected
#checklist
cchheecckklliisstt -- File systems to check when booting COHERENT
/eettcc/cchheecckklliisstt
#chgrp
cchhggrrpp -- Change the group owner of a file
cchhggrrpp _g_r_o_u_p _f_i_l_e ...
#chmod
cchhmmoodd -- Change the modes of a file
cchhmmoodd +_m_o_d_e_s _f_i_l_e
cchhmmoodd -_m_o_d_e_s _f_i_l_e
Mode may be octal or a comma-separated symbolic list: [_w_h_i_c_h]_h_o_w_p_e_r_m...[,...]
_w_h_i_c_h:
aa User, group, and other permissions
gg Group permissions
oo Other permissions
uu User permissions
Missing _w_h_i_c_h implies that `a', `g', `o', and `u' can be combined.
_h_o_w:
= Set permissions
+ Add permissions
- Take away permissions
_p_e_r_m:
gg Current group permissions
oo Current other permissions
rr Read
ss Setuid on execution
tt Sticky bit (save text)
uu Current user permissions
ww Write
xx Execute
#chmog
cchhmmoogg -- Change mode, owner, and group simultaneously
cchhmmoogg _m_o_d _o_w_n _g_r_p _f_i_l_e ...
#chown
cchhoowwnn -- Change the owner of files
cchhoowwnn _o_w_n_e_r _f_i_l_e ...
#chroot
cchhrroooott -- Change root directory
cchhrroooott _d_i_r_e_c_t_o_r_y _p_r_o_g_r_a_m ...
#ckermit
cckkeerrmmiitt -- Interactive inter-system communication and file transfer
cckkeerrmmiitt [-aabbccddeeffgghhiikkllppqqrrssttwwxx] [ _f_i_l_e ... ]
_O_p_t_i_o_n_s
-aa _f_i_l_e_n_a_m_e
Give an alternate name to file
-bb _b_a_u_d_r_a_t_e
Set the baud rate of the device to _b_a_u_d_r_a_t_e
-cc Connect
-dd Use debug mode
-ee _n Set the length of the packet to _n
-ff Send a ``finish'' command to a remote server
-gg _f_i_l_e Ask a remote system to send _f_i_l_e
-hh Print help
-ii Specify that the file being transferred is binary
-kk Passively receive files
-ll _d_e_v_i_c_e Name the serial device to be used
-nn Like -cc, but used after a protocol transaction has occurred
-pp _x Set parity to _x
-qq Quiet mode -- no messages
-rr Receive files
-ss _f_i_l_e Send _f_i_l_e
-tt Specify half duplex
-ww Write-protect -- avoid file-name collisions for incoming files
-xx Begin server operation
#clear
cclleeaarr -- Clear the screen
cclleeaarr
#clri
ccllrrii -- Clear i-node
/eettcc/ccllrrii _f_i_l_e_s_y_s_t_e_m _i_n_u_m_b_e_r ...
#cmp
ccmmpp -- Compare bytes of two files
ccmmpp [-llss] _f_i_l_e_1 _f_i_l_e_2 [_s_k_i_p_1 _s_k_i_p_2]
_O_p_t_i_o_n_s:
-ll Print byte number and bytes at each difference
-ss Return status (print nothing)
If _f_i_l_e_1 is `-', use stdin. If _s_k_i_p_1 and _s_k_i_p_2 are present, they are the
number of bytes to skip before comparing _f_i_l_e_1 and _f_i_l_e_2, respectively.
#col
ccooll -- Remove reverse and half-line motions
ccooll [ -bbddffxx ][ -pp_n ]
_O_p_t_i_o_n_s:
-bb Output device cannot backspace
-dd Double spaced output
-ff The output device can handle half lines (has precedence over -dd)
-pp_n Set page buffer to _n lines (default, 128)
-xx Suppress conversion of white space to tabs on output
#comm
ccoommmm -- Print common lines
ccoommmm [ -112233 ] _f_i_l_e_1 _f_i_l_e_2
_O_p_t_i_o_n_s:
-11 Suppress column 1
-22 Suppress column 2
-33 Suppress column 3
Column 1 has lines unique to _f_i_l_e_1; column 2 has lines unique to _f_i_l_e_2; column
3 has lines common to both files. Both files should be sorted.
#compress
ccoommpprreessss -- Compress a file
ccoommpprreessss [ -ddffvvcc ] [ -bb_n_u_m ] [ -ww _t_m_p_f_i_l_e ] [ _f_i_l_e ... ] (COHERENT 286)
ccoommpprreessss [ -ddffvvcc ] [ -bb_n_u_m ] [ _f_i_l_e ... ] (COHERENT 386)
_O_p_t_i_o_n_s:
-bb_n_u_m Set compression to _n_u_m
-cc Send output to ssttddoouutt
-dd Decompress, rather than compress
-ff Force output file, even if no space saved by compression
-vv Verbose mode
-ww _t_m_p_f_i_l_e
Use _t_m_p_f_i_l_e as the workfile (default, /ddeevv/rraamm11). COHERENT 286
only.
#continue
ccoonnttiinnuuee -- Terminate current iteration of shell construct
ccoonnttiinnuuee [ _n ]
Terminate current iteration of _n (default, one) ffoorr, uunnttiill, or wwhhiillee
constructs. The shell executes ccoonnttiinnuuee directly.
#conv
ccoonnvv -- Numeric base converter
ccoonnvv [_n_u_m_b_e_r]
If no _n_u_m_b_e_r is given, reads one number per line from stdin.
#cp
ccpp -- Copy a file
ccpp [ -dd ] _o_l_d_n_a_m_e _n_e_w_n_a_m_e
ccpp [ -dd ] _f_i_l_e_1 ... _f_i_l_e_N _d_i_r_e_c_t_o_r_y
_O_p_t_i_o_n:
-dd Preserve date (_m_t_i_m_e) on destination files.
#cpdir
ccppddiirr -- Copy directory hierarchy
ccppddiirr [_o_p_t_i_o_n ... ] _d_i_r_1 _d_i_r_2
_O_p_t_i_o_n_s:
-aa Verbose file by file account on one line
-dd Preserve last-modified date
-ee Recover from errors and continue
-rr[_n] _R_e_c_u_r _n levels only (default, one)
-ss_n_a_m_e Suppress copy of _n_a_m_e, which is relative to _d_i_r_1
-tt Test and report errors -- do not change anything
-uu Update regular files if more recent
-vv Verbose file by file account
#cpio
ccppiioo -- Archiving/backup utility
ccppiioo -oo[BBaaccvv]
ccppiioo -ii[BBccddffmmrrttuuvv] [_p_a_t_t_e_r_n...]
ccppiioo -pp[aaddllmmrruuvv] _d_i_r_e_c_t_o_r_y
_O_p_t_i_o_n_s:
-aa Reset access time of input files after copying
-BB Change size of a block
-cc Write header information in ASCII rather than binary
-dd Create directories as needed
-ff_p_a_t_t_e_r_n Copy all files except those matching _p_a_t_t_e_r_n
-ii Read the standard input
-ll Link files rather than copying them
-mm Retain previous modification times
-oo_p_a_t_t_e_r_n Copy all files matching _p_a_t_t_e_r_n
-pp Read stdin for files names to copy to destination
-rr Interactively rename files
-tt Print table of contents of an existing archive
-uu Copy files unconditionally
-vv Verbose output
#cpp
ccpppp -- C preprocessor
/lliibb/ccpppp [_o_p_t_i_o_n...] [_f_i_l_e...]
_O_p_t_i_o_n_s:
-DD_V_A_R_I_A_B_L_E
Define _V_A_R_I_A_B_L_E
-II _d_i_r Search _d_i_r for header files
-oo _f_i_l_e Write output into _f_i_l_e
-UU_V_A_R_I_A_B_L_E
Undefine _V_A_R_I_A_B_L_E
#cron
ccrroonn -- Execute commands periodically
/eettcc/ccrroonn&
cron -- execute commands periodically Usage: /etc/cron& Options: None cron is
invoked only once, usually from /eettcc/rrcc. Thereafter, it sleeps in the
background, awaking periodically to check crontab files -- either the file
/uussrr/lliibb/ccrroonnttaabb if it exists, or the files in directory
/uussrr/ssppooooll/ccrroonn/ccrroonnttaabbss if /uussrr/lliibb/ccrroonnttaabb does not exist.
Entries in a crontab file consist of commands preceded by five fields; these
represent minute (0-59), hour (0-23), day of the month (1-31), month (1-12),
and day of the week (1-7). An asterisk `*' in a field means all possible
entries for that field.
#crontab
ccrroonnttaabb -- Copy a command file into the crontab directory
/uussrr/bbiinn/ccrroonnttaabb [-ll] [-rr] [-ff _f_i_l_e_n_a_m_e] [-mm[eedd]] [-uu_u_s_e_r]
_O_p_t_i_o_n:
-ff _f_i_l_e_n_a_m_e
Replace a user's command file.
-ll List your command file.
-mm[eedd] Enable/disable sending mail upon failure of a command within a
command file.
-rr Remove user's command file.
-uu_u_s_e_r Specify that the file being copied is to be applied to _u_s_e_r.
Only the superuser rroooott can execute this option.
#crypt
ccrryypptt -- Encrypt/decrypt text
ccrryypptt [_p_a_s_s_w_o_r_d]
Password is ten characters or fewer. The same password encrypts and decrypts.
#ctags
ccttaaggss -- Generate tags and refs files for vi editor
ccttaaggss [-rr] _f_i_l_e_s...
#cut
ccuutt -- Select portions of each line of its input
ccuutt -cc_l_i_s_t [_f_i_l_e ...]
ccuutt -ff_l_i_s_t [-ss] [-dd _c_h_a_r] [_f_i_l_e ...]
_O_p_t_i_o_n_s:
-cc _l_i_s_t _l_i_s_t specifies character positions
-dd _c_h_a_r Use _c_h_a_r as field delimiter
-ff _l_i_s_t _l_i_s_t specifies fields
-ss Suppress lines without field delimiters
#date
ddaattee -- Print/set the date and time
ddaattee [-ss] [-uu] [[_y_y_m_m_d_d]_h_h_m_m[._s_s]]
_O_p_t_i_o_n_s:
-ss Suppress daylight savings time conversion
-uu Print (and enter) date in Greenwich Mean Time
#db
ddbb -- Assembler-level symbolic debugger
ddbb [-ccddeeffoorrtt] [_m_a_p_f_i_l_e] [_p_r_o_g_r_a_m]
_O_p_t_i_o_n_s:
-cc Map _p_r_o_g_r_a_m as a core file
-dd Map _p_r_o_g_r_a_m as a system dump; _m_a_p_f_i_l_e defaults to /ccoohheerreenntt
-ee Next argument is object file and rest of command line is passed
to the child process
-ff Map _p_r_o_g_r_a_m as binary data
-oo _p_r_o_g_r_a_m is an object file
-rr Access all files read-only
-tt Perform input and output via /ddeevv/ttttyy rather than stdin and
stdout
By default, _p_r_o_g_r_a_m is assumed to be an object file. _m_a_p_f_i_l_e defaults to ll.oouutt
and _p_r_o_g_r_a_m defaults to ccoorree.
#dc
ddcc -- Desk calculator
ddcc [_f_i_l_e]
Arbitrary precision desk calculator with registers, using reverse-Polish
notation. Reads input from _f_i_l_e if given, then from stdin.
#dcheck
ddcchheecckk -- Check directory consistency
ddcchheecckk [-ss] [-ii _i_n_u_m_b_e_r...] _f_i_l_e_s_y_s_t_e_m ...
_O_p_t_i_o_n_s:
-ss Cause ddcchheecckk to correct link counts automatically
-ii Print information about each given i-number
#dd
dddd -- File conversion
dddd [_o_p_t_i_o_n=_v_a_l_u_e] ...
_O_p_t_i_o_n_s:
bbss=_n Set I/O buffer size to _n
ccbbss=_n Set conversion buffer size to _n
ccoonnvv=_l_i_s_t Comma-separated list of conversions:
aasscciiii Convert EBCDIC to ASCII
eebbccddiicc Convert ASCII to standard EBCDIC
iibbmm Convert ASCII to IBM print codes
llccaassee Map all letters to lower case
nnooeerrrroorr
Continue if error occurs
sswwaabb Swap byte pairs
ssyynncc Pad input to _i_b_s
uuccaassee Map all letters to upper case
ccoouunntt=_n Number of buffers to copy from input
ffiilleess=_n Number of files to copy (useful with tape)
iibbss=_n Input buffer size
iiff=_f_i_l_e Set input file to _f_i_l_e
oobbss=_n Set output block size to _n
ooff=_f_i_l_e Set output file to _f_i_l_e
sseeeekk=_n Set seek position of output to _n
sskkiipp=_n Skip _n input blocks
#deroff
ddeerrooffff -- Remove text formatting control information
ddeerrooffff [-ww] [-xx] [_f_i_l_e ...]
_O_p_t_i_o_n_s:
-ww Divide the output into words, one per line
-xx Extra knowledge of macro packages
#detab
ddeettaabb -- Replace tab characters with spaces
ddeettaabb [-tt_t_a_b_s_i_z_e]
_O_p_t_i_o_n:
-tt_t_a_b_s_i_z_e Set _t_a_b_s_i_z_e (2-256, inclusive)
#df
ddff -- Measure free space on disk
ddff [-aaiitt] _d_e_v_i_c_e
_O_p_t_i_o_n_s:
-aa Give entries only for mounted devices
-ii Summarize i-node usage
-tt Give total number of blocks on _d_e_v_i_c_e
#diff
ddiiffff -- Summarize differences between two files
ddiiffff [-bbddeeffhh] [-cc _s_y_m_b_o_l] _f_i_l_e_1 _f_i_l_e_2
_O_p_t_i_o_n_s:
-bb Ignore trailing blanks; all strings of blanks are equal
-cc _s_y_m Make ccpppp input conditionalized on _s_y_m
-dd Use -hh algorithm for large (>25,000 character) files
-ee Make eedd script
-ff Make fake (non-usable) eedd script
-hh Half-hearted algorithm (works on long files)
-ss Make sseedd script
If either _f_i_l_e_1 or _f_i_l_e_2 is `-', stdin is used. If one _f_i_l_e is a directory,
the other _f_i_l_e under that directory is used.
#diff3
ddiiffff33 -- Summarize differences among three files
ddiiffff33 [-eexx33] _f_i_l_e_1 _f_i_l_e_2 _f_i_l_e_3
_O_p_t_i_o_n_s:
-ee Make eedd script to change _f_i_l_e_2 and _f_i_l_e to _f_i_l_e_1 (changes marked
with ==== or ====33)
-xx Above script with changes marked ==== (all different)
-33 Above script with changes marked ====33 (_f_i_l_e_3 different)
#dirs
ddiirrss -- Print the contents of the directory stack
ddiirrss
sshh only.
#disable
ddiissaabbllee -- Disable a port
/eettcc/ddiissaabbllee _p_o_r_t...
#domain
ddoommaaiinn -- Set your system's mail domain
/eettcc/ddoommaaiinn
#dos
ddooss -- Manipulate files on MS-DOS file systems
ddooss [-]ddFFllrrttxx[_f_l_a_g_s] [_d_e_v_i_c_e] [_f_i_l_e ...]
_C_o_m_m_a_n_d_s:
dd Delete specified files
FF Build MS-DOS file system (format)
ll[_l_a_b_e_l] Label disk
rr Replace _f_i_l_e_s (default, all files in `.')
tt List contents (default, all files)
xx Extract specified _f_i_l_e_s (default, all files)
_F_l_a_g_s:
aa ASCII data extract/replace (default, binary data)
cc Read only; do not write changes to MS-DOS file system
kk Keep _m_t_i_m_e on extract/replace (default, now)
nn Newest files first in list (default, alphabetized)
pp Piped extract/replace
ss_d_i_r Suppress subdirectory _d_i_r
vv Verbose
[11-99] Specify logical drive on extended MS-DOS partition
The default device is /ddeevv/ddooss.
#doscat
ddoossccaatt -- Concatenate a file on an MS-DOS file system
ddoossccaatt _d_e_v_i_c_e:[/_d_i_r_e_c_t_o_r_y/]_f_i_l_e
#doscp
ddoossccpp -- Copy files to/from an MS-DOS file system
ddoossccpp [-aabbkkmmrrvv] _s_r_c _d_e_s_t
_O_p_t_i_o_n_s
aa ASCII. When copying from MS-DOS to COHERENT, convert the
carriage-return/newline combination to newline characters; when
copying from COHERENT to MS-DOS, do the opposite.
bb Binary. Do not convert newline conversion.
kk Keep the time stamp on copied files.
mm Move. Same as aa, described above.
rr Same as bb, described above.
vv Verbose. Describe each action as it is executed.
#doscpdir
ddoossccppddiirr -- Copy a directory to/from an MS-DOS file system
ddoossccppddiirr [-aakkmmvv] _s_r_c _d_e_s_t
_O_p_t_i_o_n_s
aa ASCII. When copying from MS-DOS to COHERENT, convert the
carriage-return/newline combination to newline characters; when
copying from COHERENT to MS-DOS, do the opposite.
kk Keep the time stamp on copied files.
mm Move. Same as aa, described above.
vv Verbose. Describe each action as it is executed.
#dosdel
ddoossddeell -- Delete a file from an MS-DOS file system
ddoossddeell [-vv] _d_e_v_i_c_e:/_d_i_r/_f_i_l_e
_O_p_t_i_o_n
vv Verbose. Describe each action as it is executed.
#dosdir
ddoossddiirr -- List contents of an MS-DOS directory
ddoossddiirr [-nnvv] _d_e_v_i_c_e:[_d_i_r/][_f_i_l_e]
_O_p_t_i_o_n_s
nn List files in order of creation (newest file last) rather than
in alphabetical order.
vv Verbose. Describe each action as it is executed.
#dosformat
ddoossffoorrmmaatt -- Format a floppy disk
ddoossffoorrmmaatt [-vv] _d_e_v_i_c_e
_O_p_t_i_o_n
vv Verbose. Describe each action as it is executed.
#doslabel
ddoossllaabbeell -- Label an MS-DOS floppy disk
ddoossllaabbeell [-vv] _d_e_v_i_c_e: _l_a_b_e_l
_O_p_t_i_o_n
vv Verbose. Describe each action as it is executed.
#dosls
ddoossllss -- List files on an MS-DOS file system
ddoossllss [-vv] _d_e_v_i_c_e:[/_d_i_r_e_c_t_o_r_y/][_f_i_l_e]
_O_p_t_i_o_n:
-vv Print output in long format, analogous to llss -ll.
#dosmkdir
ddoossmmkkddiirr -- Create a directory in an MS-DOS file system
ddoossmmkkddiirr _d_e_v_i_c_e:_d_i_r_e_c_t_o_r_y
#dosrm
ddoossrrmm -- Remove a file from an MS-DOS file system
ddoossrrmm _d_e_v_i_c_e:[/_d_i_r_e_c_t_o_r_y/]_f_i_l_e
#dosrmdir
ddoossrrmmddiirr -- Remove a directory from an MS-DOS file system
ddoossrrmmddiirr _d_e_v_i_c_e:_d_i_r_e_c_t_o_r_y
#drvld
ddrrvvlldd -- Load a loadable driver into memory
/eettcc/ddrrvvlldd _o_p_t_i_o_n_s _d_r_i_v_e_r
_O_p_t_i_o_n_s:
-kk _k_e_r_n_e_l Use the symbol table from _k_e_r_n_e_l instead of the default
/ccoohheerreenntt.
-rr Remove any temporary files it creates in directory /ttmmpp.
-oo _o_u_t_f_i_l_e
Write debugginf symbol table to _o_u_t_f_i_l_e rather than to
/ttmmpp/_d_r_i_v_e_r.
#drvld.all
ddrrvvlldd.aallll -- Load loadable drivers at boot time
/eettcc/ddrrvvlldd.aallll
#du
dduu -- Summarize disk usage
dduu [-aa] [-ss] [_d_i_r_e_c_t_o_r_y ...]
_O_p_t_i_o_n_s:
-aa Print an entry for each file
-ss Print only a summary
#dump
dduummpp -- File-system backup utility
dduummpp [_o_p_t_i_o_n_s] [_a_r_g_u_m_e_n_t ...]
_O_p_t_i_o_n_s:
00-99 Set dump level (default, 9)
bb Next argument is blocking factor (default, 20)
dd Next argument is density in bpi (default, 1600)
ff Next argument is output device name
ss Next argument is tape length in feet (default, 2300)
SS Next argument is floppy disk size in blocks
uu Update /eettcc/ddddaattee
vv Verbose (display date and tape length)
#dumpdate
dduummppddaattee -- Print dump dates
dduummppddaattee [_f_i_l_e_s_y_s_t_e_m ...]
#dumpdir
dduummppddiirr -- Print the directory of a dump
dduummppddiirr [aaff [_a_r_g_u_m_e_n_t ...] ]
_O_p_t_i_o_n_s:
aa List normally suppressed `.' and `..' names
ff Next argument is dump device name (default, /ddeevv/dduummpp)
#echo
eecchhoo -- Repeat/expand an argument
eecchhoo [-nn] [_a_r_g_u_m_e_n_t ...]
_O_p_t_i_o_n:
-nn Do not print terminal newline
Copies all command arguments to the standard output, with the following
special-character sequences being replaced with the equivalent ASCII character:
\bb Backspace
\cc Print line without a newline (like -nn option)
\ff Formfeed
\nn Newline
\rr Carriage return
\tt Tab
\vv Vertical tab
\\ Backslash
\_n_n_n _n_n_n is octal value of desired character
#ed
eedd -- Interactive line editor
eedd [-] [+ccmmooppssvv] [_f_i_l_e]
_O_p_t_i_o_n_s:
- Suppress character counts on rr, ww, ee commands
-xx Encrypt _f_i_l_e
+cc Print character counts on rr, ww, ee
+mm Allow multiple commands per line
+oo Print line counts instead of character counts
+pp Prompt for each command with `*'
+ss Lower case matches upper in patterns
+vv Verbose error messages
#egrep
eeggrreepp -- Extended pattern search
eeggrreepp [_o_p_t_i_o_n ...] [_p_a_t_t_e_r_n] [_f_i_l_e ...]
_O_p_t_i_o_n_s:
-AA Build _e_r_r_o_r _l_i_s_t for interactive editing using MicroEMACS, like
-AA option to the cccc command
-bb Each output line has block number of match
-cc Print only a count of the matching lines
-ee Next argument is _p_a_t_t_e_r_n
-ff Next argument is file with one pattern per line
-hh Suppress printing of file names on matched lines
-ll Print only names of files containing matches
-nn Print line number of file with each matched line output
-ss Suppress output, just return status
-vv Negate the sense of match
-yy Lower-case letters in _p_a_t_t_e_r_n match upper- and lower-case
The _p_a_t_t_e_r_n is a pattern roughly like that found in eedd. If no _f_i_l_e is
specified, stdin is read. eeggrreepp is like ggrreepp -aa, but is an order of magnitude
faster.
#elvis
eellvviiss -- Clone of Berkeley-standard screen editor
eellvviiss [ _o_p_t_i_o_n_s ] [ +_c_m_d ] [ _f_i_l_e_1 ... _f_i_l_e_2_7 ]
_O_p_t_i_o_n_s:
-ee Begin in colon-command mode
-ii Begin in input mode
-rr Recover a previous edit
-RR Read-only mode
-tt _t_a_g Begin editing at _t_a_g
-mm Use in error-handling mode
-vv Begin in visual-command mode
+_c_o_m_m_a_n_d Execute _c_o_m_m_a_n_d before editing
#enable
eennaabbllee -- Enable a port
/eettcc/eennaabbllee _p_o_r_t...
#env
eennvv -- Execute a command in an environment
eennvv [-] [_V_A_R_I_A_B_L_E=_v_a_l_u_e ...] [_c_o_m_m_a_n_d _a_r_g_s]
#epson
eeppssoonn -- Print files on Epson printer
eeppssoonn [ -ccddffrrww88 ] [ -bb _h_e_a_d ] [ -ii _n ] [ -oo _o_f_i_l_e ] [ -ss _n ] [ _f_i_l_e ... ]
_O_p_t_i_o_n_s:
bb _h_e_a_d Print wide banner _h_e_a_d at top of first page
cc Compressed printing
dd Print boldface with double strike, not emphasize mode
ff Suppress formfeed after each _f_i_l_e
ii_n Indent output 'n' spaces
oo _o_f_i_l_e Send output to _o_f_i_l_e (default, /ddeevv/llpp)
rr Use only Roman character set (no italics)
ss_n Vertical spacing _n (default, 1)
ww Double-width printing
88 Eight lines per inch (default, six)
#eval
eevvaall -- Evaluate arguments
eevvaall [_t_o_k_e_n ...]
The shell executes eevvaall directly.
#ex
eexx -- Berkeley-style line editor
eexx [ _o_p_t_i_o_n_s ] [ +_c_m_d ] [ _f_i_l_e_1 ... _f_i_l_e_2_7 ]
_O_p_t_i_o_n_s:
-rr Recover a previous edit
-RR Read-only mode
-tt _t_a_g Begin editing at _t_a_g
-mm Use in error-handling mode
+_c_o_m_m_a_n_d Execute _c_o_m_m_a_n_d before editing
#exec
eexxeecc -- Execute command directly
eexxeecc [_c_o_m_m_a_n_d]
The shell executes _c_o_m_m_a_n_d by eexxeecc rather than ffoorrkk. This normally terminates
the current shell. Current shell I/O may be redirected by eexxeecc with no
_c_o_m_m_a_n_d.
#exit
eexxiitt -- Exit from a shell
eexxiitt [_s_t_a_t_u_s]
The previous status is retained if none is specified. eexxiitt sets the status but
does not terminate an interactive shell. The shell executes eexxiitt directly.
#export
eexxppoorrtt -- Add a shell variable to the environment
eexxppoorrtt [_n_a_m_e ...]
eexxppoorrtt [_n_a_m_e=_v_a_l_u_e]
#expr
eexxpprr -- Compute a command-line expression
eexxpprr _a_r_g_u_m_e_n_t ...
_O_p_t_i_o_n_s:
nn Any integer with optional sign
_s_t_r_i_n_g Used with comparisons and lleenn operator
+ Arithmetic operators (one of `+', `-', `*', `/', `%')
! Unary not
- Unary minus
== Relational operators (one of `>', `<', `>=', `<=', `==', `!=')
& Logical AND of previous and next expression
| Logical OR of previous and next expression
lleenn Length of string given by next argument
_e_1:_e_2 Set to number of characters matching regular expression _e_2 in
string _e_1; if _e_2 contains any `\(...\)' sequences, result is
concatenation of matched parts
( _e ) Parentheses for grouping
{
EEvvaalluuaattee _e_2 if _e_1 is true, _e_3 otherwise; _e_3 defaults to 0 if
missing
#factor
ffaaccttoorr -- Factor a number
ffaaccttoorr [ _n_u_m_b_e_r ... ]
#false
ffaallssee -- Unconditional failure
ffaallssee
#fc
ffcc -- Edit and re-execute one or more previous commands
ffcc [-llnn] [_f_i_r_s_t [_l_a_s_t]]
ffcc -ss [_o_l_d=_n_e_w] [_c_o_m_m_a_n_d]"
_O_p_t_i_o_n_s:
-ll Print commands on stdout
-nn Suppress default command numbers
kksshh only.
#fdformat
ffddffoorrmmaatt -- Low-level format a floppy disk
/eettcc/ffddffoorrmmaatt [ _o_p_t_i_o_n ... ] _s_p_e_c_i_a_l
_O_p_t_i_o_n_s:
-aa Print information on stdout during format
-ii _n Interleave factor _n (0-7; default, 6)
-oo _n Skew factor _n for sector numbering (default, 0)
-vv Verify
-ww _f_i_l_e Copy _f_i_l_e to formatted floppy disk track by track
#fdisk
ffddiisskk -- Hard-disk partitioning utility
/eettcc/ffddiisskk [-rr] [-cc] [-bb _m_b_o_o_t] _x_d_e_v ...
_O_p_t_i_o_n_s:
-rr Read-only access
-bb Add master boot code from file _m_b_o_o_t
-cc Specify disk geometry for non-standard drives
A hard disk can be split into a maximum of four partitions (logical devices).
#file
ffiillee -- Guess a file's type
ffiillee _f_i_l_e ...
#find
ffiinndd -- Search for files satisfying a pattern
ffiinndd _d_i_r_e_c_t_o_r_y ... [_e_x_p_r_e_s_s_i_o_n ...]
_E_x_p_r_e_s_s_i_o_n:
-aattiimmee _n File has been accessed in _n days
-ccttiimmee _n File's i-node has been changed in _n days
-eexxeecc _c_m_d Command _c_m_d is successful
-ggrroouupp _g_n File belongs to group _g_n
-iinnuumm _n File has i-node _n
-lliinnkkss _n File has _n links to it
-mmttiimmee _n File has been modified within _n days
-nnaammee _p_a_t_t_e_r_n
File name matches _p_a_t_t_e_r_n (shell conventions)
-nneewweerr_f_i_l_e
File has been modified since _f_i_l_e
-nnoopp Always true; does nothing
-ookk _c_m_d Like -eexxeecc, except it asks
-ppeerrmm _o_c_t_a_l
File permissions are _o_c_t_a_l
-pprriinntt Always true; prints current path name
-ssiizzee _n File is _n blocks long
-ttyyppee _c File matches type (_c may be [bcdfmp])
-uusseerr _u_n_a_m_e
_u_n_a_m_e owns file
eexxpp -aa _e_x_p _e_x_p
Both expressions are true
eexxpp -oo _e_x_p _e_x_p
One of the expressions is true
! _e_x_p Expression is false
(_e_x_p) Parentheses for grouping
If no expression is specified, -pprriinntt is assumed.
#fixstack
ffiixxssttaacckk -- Change stack allocation
ffiixxssttaacckk +-_v_a_l_u_e [ _f_i_l_e_n_a_m_e ]
This command applies to COHERENT 286 only
#fnkey
ffnnkkeeyy -- Set/print function keys for the console
ffnnkkeeyy [ _n [ _s_t_r_i_n_g ] ]
Sets function key _n to send _s_t_r_i_n_g; if no _s_t_r_i_n_g, set it to send nothing. If
no arguments, ffnnkkeeyy prints the function keys.
#for
ffoorr -- Execute commands for tokens in list
ffoorr _n_a_m_e [iinn _t_o_k_e_n ...] ddoo _s_e_q_u_e_n_c_e ddoonnee
If _i_n clause is omitted, list of positional parameters to current script is
assumed. Both ddoo and ddoonnee must be first token on line or preceded by `;'. The
shell executes ffoorr directly.
#fortune
ffoorrttuunnee -- Print randomly selected, hopefully humorous, text
/uussrr/ggaammeess/ffoorrttuunnee [ _f_i_l_e ]
_O_p_t_i_o_n:
_f_i_l_e Read a fortune from _f_i_l_e, instead of the default file
/uussrr/ggaammeess/lliibb/ffoorrttuunneess
#from
ffrroomm -- Generate list of numbers, for use in loop
ffrroomm _s_t_a_r_t ttoo _s_t_o_p [ bbyy _i_n_c_r ]
_s_t_a_r_t, _s_t_o_p, and _i_n_c_r (default, one) are decimal integers with optional `-'.
#fsck
ffsscckk -- Check and repair file systems interactively
/eettcc/ffsscckk [ -ffnnqqssSSyy ] [ -tt _t_e_m_p_f_i_l_e ] [ _f_i_l_e_s_y_s_t_e_m ... ]
_O_p_t_i_o_n_s:
-ff Fast check; check only if a block is claimed by more than one i-
node, by an i-node and the free list, or more than once in the
free list
-nn Default reply of no to all queries
-qq Quiet option; syppress file name warning messages
-ss Force reconstruction of the free list for all unmounted file
systems.
-SS Same as -ss, but works on mounted file systems as well. Not for
the faint of heart.
-tt Use _t_e_m_p_f_i_l_e instead of /ddeevv/rrrraamm11 for temporary storage
-yy Default reply of yes to all queries
#fwtable
ffwwttaabbllee -- Build font-width table
ffwwttaabbllee [ -ppvv ] [ _i_n_f_i_l_e [ _o_u_t_f_i_l_e ] ]
_O_p_t_i_o_n_s:
-pp Input is PostScript AFM file, not PCL bitmap font
-vv Write a brief font description to stderr
#getopts
ggeettooppttss -- Parse command-line options
ggeettooppttss _o_p_t_s_t_r_i_n_g _n_a_m_e [ _o_p_t ]
kksshh only.
#getty
ggeettttyy -- Terminal initialization
/eettcc/ggeettttyy _t_y_p_e
#grep
ggrreepp -- Pattern search
ggrreepp [ooppttiioonn ...] [_p_a_t_t_e_r_n] [_f_i_l_e ...]
_O_p_t_i_o_n_s:
-aa Extra metacharacters supported (`(...)', `|', `+', and `?')
-bb Each output line has block number of match
-cc Print only count of matching lines
-ee Next argument is pattern
-ff Next argument is file containing one pattern per line
-hh Suppress printing of file names on matched lines
-ll Print only names of files containing matches
-nn Print line number of file with each matched line output
-ss Suppress output, just return status
-vv Negate sense of match
-xx Exact match (don't expand metacharacters)
-yy Lower-case letters in _p_a_t_t_e_r_n match upper- and lower-case
The _p_a_t_t_e_r_n is a regular expression roughly like that found in eedd. If no _f_i_l_e
is specified, stdin is read.
#guess
gguueessss -- Extraordinarily amusing guessing game
/uussrr/ggaammeess/gguueessss
#hash
hhaasshh -- Add a command to the shell's hash table
hhaasshh [-rr] [_c_o_m_m_a_n_d ... ]
_O_p_t_i_o_n:
-rr Remove _c_o_m_m_a_n_d from hash table
kksshh only.
#head
hheeaadd -- Print the beginning of a file
hheeaadd [+_n[bbccll]] [_f_i_l_e]
hheeaadd [-_n[bbccll]] [_f_i_l_e]
_O_p_t_i_o_n_s:
+ Count from beginning of file
- Count from end of file
bb Count in blocks
cc Count in characters
ll Count in lines
#help
hheellpp -- Print concise description of command
hheellpp [-dd_c] [-ff_f_i_l_e] [-ii_f_i_l_e] [-rr] [_c_o_m_m_a_n_d]...
_O_p_t_i_o_n_s
-dd_c Use character _c as the delimiter between helpfile entries.
-ff_f_i_l_e Read _f_i_l_e as the helpfile, instead of the default /eettcc/hheellppffiillee.
-ii_f_i_l_e Read _f_i_l_e as the helpfile's index, instead of the default
/eettcc/hheellppiinnddeexx.
-rr Rebuild the helpfile's index.
If _c_o_m_m_a_n_d is omitted, print information about $LLAASSTTEERRRROORR.
#hp
hhpp -- Prepare files for Hewlett-Packard LaserJet printer
hhpp [ -aaccffllrr ] [ -ii_m_a_r_g ] [ -tt_t_o_p ] [ -pp_l_i_n_e_s ] [ _f_i_l_e ... ]
_O_p_t_i_o_n_s:
-aa Substitute ` ' for '
-cc Toggle cartridge in place switch
-ff Print pages in forward order (default)
-ll Landscape mode
-ii_m_a_r_g Indent to _m_a_r_g
-pp_l_i_n_e_s Page length is _l_i_n_e_s
-rr Print pages in reverse order (for LaserJet I).
-tt_m_a_r_g Set top margin to _m_a_r_g
#hpd
hhppdd -- Hewlett-Packard LaserJet printer spooler daemon
/uussrr/lliibb/hhppdd
#hpr
hhpprr -- Send file to Hewlett-Packard LaserJet printer spooler
hhpprr [-BBcceemmnnrr] [-bb _b_a_n_n_e_r] [ -ff _f_o_n_t_n_u_m] [_f_i_l_e ...]
_O_p_t_i_o_n_s:
-BB Suppress banner page and extra page at termination. _M_u_s_t be
used with a PostScript printer.
-bb Next argument is the banner
-cc Make a copy of each _f_i_l_e in spool area
-ee Erase all fonts from printer's memory
-ff _f_o_n_t_n_u_m _f_i_l_e_1 ... _f_i_l_e_N
Load into printer memory the HP soft fonts in _f_i_l_e_1 through
_f_i_l_e_N; set font identifiers beginning with _f_o_n_t_n_u_m
-mm Send a message when listing is complete
-nn No message (default)
-rr Remove files when they have been spooled
#hpskip
hhppsskkiipp -- Abort/restart current listing on Hewlett-Packard LaserJet
hhppsskkiipp [-rr]
_O_p_t_i_o_n:
-rr Restarts the current listing
#icheck
iicchheecckk -- i-node consistency check
iicchheecckk [-ss] [-bb _N ...] [ -vv ] _f_i_l_e_s_y_s_t_e_m ...
_O_p_t_i_o_n_s:
-bb The following numeric arguments give block numbers; all
references to these blocks are printed, with type
-ss Repair file system (requires write access)
-vv Print summary of information about file system
#if
iiff -- Execute a command conditionally
iiff _s_e_q_u_e_n_c_e_1 tthheenn _s_e_q_u_e_n_c_e_2 [eelliiff _s_e_q_u_e_n_c_e_3 tthheenn _s_e_q_u_e_n_c_e_4] ... [eellssee _s_e_q_u_e_n_c_e_5] ffii
Each tthheenn, eelliiff, eellssee, and ffii must occur unquoted at the start of a line or
preceded by `;'. The shell executes iiff directly.
#infocmp
iinnffooccmmpp -- De-compile a terminfo file
iinnffooccmmpp [_f_i_l_e ... ]
#init
iinniitt -- System initialization
/eettcc/iinniitt
init -- System initialization Usage: /etc/init
#install
iinnssttaallll -- Install a software update onto COHERENT
/eettcc/iinnssttaallll _i_d _d_e_v_i_c_e _n_d_i_s_k_s
_A_r_g_u_m_e_n_t_s:
_i_d String that identifies the release; e.g., ccoohh.330011 identifies
COHERENT release version 3.0.1.
_d_e_v_i_c_e The physical device from which the installation takes place;
e.g., /ddeevv/ffhhaa00 identifies floppy-disk drive 0 (drive A), where
it is a high-density, 5.25-inch disk.
_n_d_i_s_k_s Number of floppy disks in the release.
#jobs
jjoobbss -- Print information about jobs
jjoobbss
kksshh only.
#join
jjooiinn -- Join two data bases
jjooiinn [-aa [_n] ] [-ee _s_t_r_i_n_g ] [-jj[_n] _k_e_y_f] [-oo _n._m ...] [-tt_c] _f_i_l_e_1 _f_i_l_e_2
_O_p_t_i_o_n_s:
-aa[_n] Print unpaired records from file _n
-ee _s Replace empty fields on output with string _s
-jj[_n] _k_e_y Use _k_e_y of file _n for comparison
-oo [_n.]_m ..
Subsequent arguments list fields to output; each has file _n and
field number _m
-tt_c Field separator is character _c
If either _f_i_l_e_1 or _f_i_l_e_2 is `-', stdin is used. The optional file _n may be
either 1 or 2; if omitted, both 1 and 2 are assumed.
#kermit
kkeerrmmiitt -- Inter-system communication and file transfer
kkeerrmmiitt cc[bbeellLL _b_a_u_d _e_s_c _l_i_n_e]
kkeerrmmiitt rr[bbddffhhiillLLtt _b_a_u_d _l_i_n_e]
kkeerrmmiitt ss[aabbddffhhiillLLmmttxx _b_a_u_d _l_i_n_e] _f_i_l_e ...
_M_o_d_e_s:
cc Connect
rr Receive
ss Send
_O_p_t_i_o_n_s:
aa Specify path for sending and receiving files
bb _b_a_u_d Use given baud rate
dd Print debug information
ee _e_s_c Use _e_s_c as escape character (default, `^')
ff Suppress file-name conversion
hh Host mode
ii Image mode (for non-ASCII transfer)
ll _l_i_n_e Use given line
LL Log all commands into file LLoogg
mm Macintosh mode
tt Tymnet mode
xx Use complete path name for receiving file
_C_o_m_m_a_n_d_s:
_e_s_ccc Exit from kkeerrmmiitt
_e_s_css Suspend kkeerrmmiitt
#kill
kkiillll -- Signal a process
kkiillll [- _s_i_g_n_a_l ] _p_i_d ...
#ksh
kksshh -- The Korn shell
kksshh _t_o_k_e_n ...
#l
ll -- List directory's contents in long format
ll [_f_i_l_e ...]
#lc
llcc -- List directory's contents in columnar format
llcc [ -11aabbccddffpp ] [ _d_i_r_e_c_t_o_r_y ...]
_O_p_t_i_o_n_s:
-11 List files one per line instead of in columns
-aa List all files in directory (including `.' and `..')
-bb List block-special files only
-cc List character-special files only
-dd List directories only
-ff List regular files only
-pp List pipe files only
Options can be combined. If no _d_i_r_e_c_t_o_r_y is specified, the current directory
is used.
#ld
lldd -- Link relocatable object modules
lldd [_o_p_t_i_o_n ...] _f_i_l_e ...
_O_p_t_i_o_n_s:
-dd Define commons (even if undefined symbols). COHERENT 286 only.
-ee _e_n_t Set entry point to symbol or octal number
-ff (Force) Force link even if there are errors
-ii Bind output sepid
-KK Rebuilt a new kernel.
-LL_d_i_r_e_c_t_o_r_y
Search _d_i_r_e_c_t_o_r_y for libraries and objects before searching the
directories named in the environmental variable LLIIBBPPAATTHH
-ll_l_i_b Use standard library _l_i_b
-oo _f_i_l_e Write output into _f_i_l_e (default, _l._o_u_t)
-qq (Quiet) Suppress all warning messages
-QQ Quiet: Suppress all error messages
-rr Retain relocation information
-ss Discard symbol table
-uu _s_y_m Undefine _s_y_m (force library search)
-xx Discard all local symbols
-XX Discard C internal local symbols
#let
lleett -- Evaluate an expression
lleett [_e_x_p_r_e_s_s_i_o_n]
kksshh only.
#lex
lleexx -- Lexical analyzer generator
lleexx [-tt][-vv][_f_i_l_e]
cccc lleexx.yyyy.cc -llll
_O_p_t_i_o_n_s:
-tt Write to standard output instead of lleexx.yyyy.cc
-vv Give statistics about generated tables
#lf
llff -- List directory's contents in columnar format
llff [_f_i_l_e ...]
#lines
lliinneess -- Highly amusing board game
/uussrr/ggaammeess/lliinneess
#ln
llnn -- Create a link to a file
llnn [-ff] _o_l_d_f_i_l_e _n_e_w_f_i_l_e
llnn [-ff] _o_l_d_f_i_l_e ... _d_i_r_e_c_t_o_r_y
_O_p_t_i_o_n:
-ff Force link even if _n_e_w_f_i_l_e exists
#login
llooggiinn -- Log in or change user name
llooggiinn [_u_s_e_r_n_a_m_e]
#logmsg
llooggmmssgg -- Hold COHERENT Login Message
/eettcc/llooggmmssgg
#look
llooookk -- Find matching lines in a sorted file
llooookk [-ddff] _s_t_r_i_n_g [_f_i_l_e]
_O_p_t_i_o_n_s:
-dd Dictionary ordering
-ff Fold cases for comparison
If no _f_i_l_e, llooookk uses /uussrr/ddiicctt/wwoorrddss with -ddff option.
#lpd
llppdd -- Line printer spooler daemon
/uussrr/lliibb/llppdd
#lpr
llpprr -- Send to line printer spooler
llpprr [-ccmmnnrr] [-bb _b_a_n_n_e_r] [_f_i_l_e ...]
_O_p_t_i_o_n_s:
-BB Suppress printing of a banner. This option mmuusstt be used with
PostScript printers.
-bb Next argument is the banner
-cc Copy each _f_i_l_e in spool area
-mm Send a message when listing is complete
-nn No message (default)
-rr Remove files when they have been spooled
#lpskip
llppsskkiipp -- Terminate/restart current line printer listing
llppsskkiipp [-rr]
_O_p_t_i_o_n:
-rr Restart current listing
With no argument, terminate current listing.
#lr
llrr -- List subdirectories' contents in columnar format
llrr [_f_i_l_e ...]
#ls
llss -- List directory's contents
llss [-aabbCCccddFFffggiillmmnnooppqqRRrrssttuuxx] [_f_i_l_e ... ]
_O_p_t_i_o_n_s:
-aa List all files (including `.' and `..')
-bb Print non-graphic characters in octal
-CC Print output in multi-column format, sorted down the columns
-cc Use attribute change instead of modified time for -ll and -tt
-dd Treat directories like files
-FF Print `/' after directories and `*' after executables
-ff Treat _f_i_l_e as a directory even if it is not
-ii Print the i-number as well
-ll Long format: show file type, permissions, size
-mm Output file names separated by commas
-nn Same as -ll
-pp Print `/' after directory names
-qq Print non-graphic characters as `?'
-RR Recursively display directories
-rr Reverse the order of all sorting
-ss Print the file size in blocks as well
-tt Sort by times, newest first
-uu Use accessed rather than modified time
-xx Print multicolumn output, sorted across the columns
#lx
llxx -- List directory's contents in columnar format
llxx [_f_i_l_e ...]
#m4
mm44 -- Macro processor
mm44 [ffiillee ...]
If _f_i_l_e is `-' or omitted, mm44 reads the standard input.
#mail
mmaaiill -- Computer mail
mmaaiill [-mmppqqrrvv] [-ff _f_i_l_e] [_u_s_e_r ...]
_O_p_t_i_o_n_s:
-ff _f_i_l_e Print mail from _f_i_l_e instead of default
-mm Notify each logged-in recipient when mail is sent
-pp Print mail non-interactively
-qq Exit on interrupt, leaving mail unchanged
-rr Print mail in reverse order
-vv Verbose mode: show version and expanded aliases
If _u_s_e_r is present, send each a mail message read from standard input. Mail
message ends with EOF, a line containing only `.', or a line containing only
`?'; the last moves the message into editor for further editing processing
before transmission.
_C_o_m_m_a_n_d_s:
dd Delete current message; print the next
mm [_u_s_e_r ...]
Mail current message to each _u_s_e_r
pp Print this message again
qq Quit and update mailbox
rr Reverse direction of scan through mailbox
ss [_f_i_l_e ...]
Save current message with header in each _f_i_l_e
tt [_u_s_e_r ...]
Send message from stdin to each _u_s_e_r
ww [_f_i_l_e ...]
Write current message without header in each _f_i_l_e
xx Exit without updating mailbox
<nneewwlliinnee> Print the next message
- Print the previous message
EOF Quit and update mailbox; same as qq command
? Print a command summary
!_c_o_m_m_a_n_d Pass _c_o_m_m_a_n_d to the shell for execution
#make
mmaakkee -- Program building discipline
mmaakkee [_o_p_t_i_o_n ...] [_a_r_g_u_m_e_n_t ...] [_t_a_r_g_e_t ...]
_O_p_t_i_o_n_s:
-dd Debug mode
-ee Macro definitions in environment override those in makefile
-ff _f_i_l_e Instructions are in _f_i_l_e (default, [mmMM]aakkeeffiillee)
-ii Ignore command error returns
-nn Test: do all but execute commands
-pp Print macro definitions and target descriptions
-qq Only return exit status (zero if files up to date)
-rr Ignore built-in rules
-ss Do not print command lines when executed
-tt Update times of files without regenerating
#man
mmaann -- Print Lexicon entries
mmaann [-ww] [_t_o_p_i_c ...]
_O_p_t_i_o_n_s:
-ww Print only file name where document resides
With no arguments, list available topics.
#me
mmee -- MicroEMACS screen editor
mmee [-ee _e_r_r_o_r_f_i_l_e] [-ff _b_i_n_d_f_i_l_e] [_t_e_x_t_f_i_l_e ...]
_O_p_t_i_o_n_s:
-ee _e_r_r_o_r_f_i_l_e
Error-handling mode; read error messages from _e_r_r_o_r_f_i_l_e
-ff _b_i_n_d_f_i_l_e
Read keyboard bindings from _b_i_n_d_f_i_l_e
#mesg
mmeessgg -- Permit/deny messages from other users
mmeessgg [nnyy]
_O_p_t_i_o_n_s:
nn Disallow messages
yy Allow messages
With no arguments, mmeessgg prints the state.
#mkdir
mmkkddiirr -- Create a directory
mmkkddiirr [ -rr ] _d_i_r_e_c_t_o_r_y
_O_p_t_i_o_n:
-rr Make parent directories recursively as required
#mkfnames
mmkkffnnaammeess -- Generate data base of user names
mmkkffnnaammeess [_n_a_m_e_f_i_l_e ...]
#mkfs
mmkkffss -- Make a new file system
/eettcc/mmkkffss [-bb _b_o_o_t] [-dd] [-ff _n_a_m_e] [-ii _i_n_o_d_e_s] [-mm _a_r_g] [-nn _a_r_g] [-pp _p_a_c_k] _f_i_l_e_s_y_s_t_e_m _p_r_o_t_o
_O_p_t_i_o_n_s:
-bb _b_o_o_t Specifies the file to use as the ``bootstrap'' for the file
system.
-dd Preserve file dates and times.
-ff _n_a_m_e Label the file system with the given _n_a_m_e. _n_a_m_e must be less
than seven characters in length.
-ii _i_n_o_d_e_s Use _i_n_o_d_e_s as the number of inodes for the file system.
-mm _a_r_g Number of blocks to skip when incrementing virtual block number
-nn _a_r_g Size of a ``virtual cylinder''
-pp _p_a_c_k Set the file system ``pack name'' to _p_a_c_k. _p_a_c_k must be less
than seven characters in length.
If _p_r_o_t_o is a number, it is the size in blocks of an empty file system;
otherwise, it names a prototype description file, as created by the command
bbaaddssccaann.
#mknod
mmkknnoodd -- Make a special file or named pipe
/eettcc/mmkknnoodd [ -ff ] _f_i_l_e_n_a_m_e _t_y_p_e _m_a_j_o_r _m_i_n_o_r
/eettcc/mmkknnoodd [ -ff ] _f_i_l_e_n_a_m_e pp
_O_p_t_i_o_n
-ff Forces creation of a new node, even if one of same name already
exists
In first form of the command, _t_y_p_e is `b' for block special or `c' for
character special; _m_a_j_o_r and _m_i_n_o_r are numbers. The second form creates a
named pipe with the given _f_i_l_e_n_a_m_e.
#modemcap
mmooddeemmccaapp -- Modem-description language
/eettcc/mmooddeemmccaapp
#modeminit
mmooddeemmiinniitt -- Initialize a modem
/uussrr/bbiinn/mmooddeemmiinniitt
#moo
mmoooo -- Greatly amusing numeric guessing game
/uussrr/ggaammeess/mmoooo [ _n_u_m_d_i_g_i_t_s ]
#more
mmoorree -- Display text one page at a time
mmoorree [ -ccddffllssuu ] [ -_w_i_n_d_o_w__s_i_z_e ] [ +_l_i_n_e__n_u_m_b_e_r ] [ +/_p_a_t_t_e_r_n ] [ _f_i_l_e ... ] [ - ]
_O_p_t_i_o_n_s:
- Read/display stdin
-cc Paint screen from top down
-dd Prompt user to quit after each screenful of text
-ff Count lines from file rather than screen-display lines
-ll Do not treat <ccttrrll-LL> as special
-ss Squeeze consecutive blank lines into one
-uu Display backspaces as control characters
+lliinnee_nnuummbbeerr
Begin display at _l_i_n_e__n_u_m_b_e_r
+/ppaatttteerrnn Begin display at first line to contain _p_a_t_t_e_r_n
#motd
mmoottdd -- File that holds message of the day
/eettcc/mmoottdd
#mount.all
mmoouunntt.aallll -- Mount file systems at boot time
/eettcc/mmoouunntt.aallll
#mount
mmoouunntt -- Mount a file system
/eettcc/mmoouunntt [ _s_p_e_c_i_a_l _d_i_r_e_c_t_o_r_y [ -rruu ] ]
_O_p_t_i_o_n_s:
-rr Mount device read-only
-uu Update /eettcc/mmttaabb entry but do not mount device
With no arguments, print devices currently mounted. _s_p_e_c_i_a_l names a device-
special file; _d_i_r_e_c_t_o_r_y names the directory on which to mount it. File
/bbiinn/mmoouunntt contains useful abbreviations for invoking /eettcc/mmoouunntt.
#msg
mmssgg -- Send a brief message to other users
mmssgg _u_s_e_r
_m_e_s_s_a_g_e
#msgs
mmssggss -- Read messages intended for all COHERENT users
mmssggss [-_q] [_n_u_m_b_e_r]
_O_p_t_i_o_n_s:
-qq Query if new message is waiting to be read
_n_u_m_b_e_r Print message titled with given _n_u_m_b_e_r
To submit a message to mmssggss, mail it to user mmssggss.
#mv
mmvv -- Rename files or directories
mmvv [-ff] _o_l_d_f_i_l_e [_n_e_w_f_i_l_e]
mmvv [-ff] _f_i_l_e ... _d_i_r_e_c_t_o_r_y
_O_p_t_i_o_n:
-ff Force: remove _n_e_w_f_i_l_e even if unwritable
#mvdir
mmvvddiirr -- Rename a directory
/eettcc/mmvvddiirr _o_l_d_d_i_r _n_e_w_d_i_r
#ncheck
nncchheecckk -- Print file names corresponding to i-node
nncchheecckk [ -ii _n_u_m_b_e_r ... ] [ -aass ] _f_i_l_e_s_y_s_t_e_m ...
_O_p_t_i_o_n_s:
-aa Print file names including `.' and `..'
-ii _n... Print file names only for listed i-numbers _n...
-ss Print only special files and files with setuid mode
#newgrp
nneewwggrrpp -- Change to a new group
nneewwggrrpp _g_r_o_u_p
#newusr
nneewwuussrr -- Add new user to COHERENT system
/eettcc/nneewwuussrr _l_o_g_i_n "_U_s_e_r _N_a_m_e" _p_a_r_e_n_t_d_i_r [ _s_h_e_l_l ]
#nm
nnmm -- Print a program's symbol table
nnmm [ -aaddggnnoopprruu ] _f_i_l_e ...
_O_p_t_i_o_n_s:
-aa Print all symbols
-dd Print only definitions
-gg Print only global symbols
-nn Sort numerically (default, sort by name)
-oo Prepend file or member name to each line
-pp Print in symbol table order (no sort)
-rr Reverse order of sort
-uu Print undefined symbols
_f_i_l_e may be an object file or an archive.
#nptx
nnppttxx -- Generate permutations of users' full names
nnppttxx
#nroff
nnrrooffff -- Text-formatting language
nnrrooffff [_o_p_t_i_o_n ...] [_f_i_l_e ...]
_O_p_t_i_o_n_s:
-dd Debug: print each request before executing
-ff _n_a_m_e Write temporary file in file _n_a_m_e
-ii Read stdin after each _f_i_l_e has been read
-kk Keep temporary file
-mm_n_a_m_e Read macro package /uussrr/lliibb/ttmmaacc._n_a_m_e
-nn_N Number first page of output _N (default, 1)
-rr_a_N Set number register _a to value _N
-rr_a_b_N Set number register _a_b to value _N; for obvious reasons, _a_b
cannot contain a digit
-xx Do not eject to bottom of final page
#od
oodd -- Print an octal dump of a file
oodd [-bbccddooxx] [_f_i_l_e] [ [+] _o_f_f_s_e_t[.][bb] ]
_O_p_t_i_o_n_s:
-bb Dump bytes in the default base
-cc Dump bytes as ASCII characters
-dd Dump words in decimal
-oo Dump words in octal
-xx Dump words in hexadecimal
Default base is octal on the PDP-11; hexadecimal on the i80286, Z-8001, and
M68000. _o_f_f_s_e_t must be preceded by `+' if _f_i_l_e is omitted. _o_f_f_s_e_t is decimal
if `.' is present; `b' implies 512-byte blocks instead of bytes.
#passwd
ppaasssswwdd -- Set/change login password
ppaasssswwdd [_u_s_e_r]
#paste
ppaassttee -- Merge lines of files
ppaassttee [-ss] [-dd _l_i_s_t] _f_i_l_e ...
_O_p_t_i_o_n_s:
-ss Display lines of input files sequentially across page
-dd _l_i_s_t Use _l_i_s_t as delimiters for output fields
#patch
ppaattcchh -- Modify portions of an executable
/ccoonnff/ppaattcchh [-kk] _i_m_a_g_e _s_y_m_b_o_l=_v_a_l_u_e ...
_O_p_t_i_o_n_s:
-kk Patch the kernel's data memory of the running system via device
/ddeevv/kkmmeemm.
#pax
ppaaxx -- Portable archive interchange
The options are the same as those for the command ttaarr.
#phone
pphhoonnee -- Print numbers and addresses from phone directory
pphhoonnee _p_e_r_s_o_n ...
#popd
ppooppdd -- Pop an item from the directory stack
ppooppdd [_i_t_e_m ... ]
sshh only.
#pr
pprr -- Paginate and print files
pprr [ _o_p_t_i_o_n_s ] [ _f_i_l_e ...]
_O_p_t_i_o_n_s:
+_s_k_i_p Skip the first _s_k_i_p pages of input before printing
-_c_o_l_s Print the input in _c_o_l_s columns
-hh The next argument is the header (replaces file name)
-ll_n Set page size to _n lines (default, 66)
-mm Print each input _f_i_l_e in a separate column
-nn Number the output lines
-ss_c Separate each column with character _c
-tt Suppress top and bottom margins and header
-ww_n Page width is set to _n columns (default, 80)
A _f_i_l_e named `-' means stdin.
#prep
pprreepp -- Produce a word list
pprreepp [ -ddffpp ] [ -ii _i_f_i_l_e ] [ -oo _o_f_i_l_e ] [ _f_i_l_e ... ]
_O_p_t_i_o_n_s:
-dd Print number of each word output
-ff Fold upper case to lower case
-ii _f_i_l_e Ignore all words in _f_i_l_e on output
-oo _f_i_l_e Output only words from _f_i_l_e
-pp Print punctuation marks on separate lines (not numbered)
Text is taken from each input _f_i_l_e or stdin if none. Words consist of
alphabetic characters and apostrophes.
#print
pprriinntt -- Echo text onto the standard output
pprriinntt [-eennrruu_n] [_a_r_g_u_m_e_n_t ...]
_O_p_t_i_o_n_s:
-ee Re-enable expansion of C escape sequences
-nn Don't print newline after list of arguments
-rr Suppress expansion of C escape sequences
-uu_n Redirect output file descriptor _n
kksshh only.
#prof
pprrooff -- Print execution profile of a C program
pprrooff [ -aabbccss ][ _p_r_o_g_f_i_l_e [ _m_o_n_f_i_l_e ] ]
_O_p_t_i_o_n_s:
-aa Use all symbols, not just externals
-bb Print all bin information
-cc Print all call information
-ss Report stack usage high water mark
The default _p_r_o_g_f_i_l_e is ll.oouutt; the default _m_o_n_f_i_l_e, mmoonn.oouutt.
#profile
pprrooffiillee -- Set user's environment at login
/eettcc/pprrooffiillee
#.profile
.pprrooffiillee -- Set user's personal environment at login
$HHOOMMEE/.pprrooffiillee
#prps
pprrppss -- Prepare files for PostScript-compatible printer
pprrppss [_o_p_t_i_o_n_s] [_f_i_l_e ... ]
_O_p_t_i_o_n_s:
-_p_t_s_i_z_e Use _p_t_s_i_z_e as the point size (default, 10)
-bb Suppress the box around the page text
-ff_f_o_n_t Use the given font name (default, Courier)
-FF_X Use font X, which must be [ABHNPST]
-FF_s_f_x Use _s_f_x as suffix for font X, which must be [RRBBII]. Default
suffixes are "" (R), -BBoolldd (B), -OObblliiqquuee (I)
-hh Suppress the header line
-ll Landscape mode (default, portrait)
-ll22 Landscape mode, two pages per output page
-nn_h_e_a_d Use _h_e_a_d in header line
-pp_N Print _N lines of text per output page
-tt_N Set tab stops to every _N characters (default, 8)
+_N Skip first _N output pages
#ps
ppss -- Print process status
ppss [ -aaffggllmmnnrrttwwxx ] [ -cc _s_y_s ] [ -kk _m_e_m ]
_O_p_t_i_o_n_s:
-aa Print all terminals' processes
-cc _s_y_s Next argument is system (default, /ccoohheerreenntt)
-dd Print status of loadable drivers
-ff Put `-' in null fields for placeholders
-gg Give group leader for this process
-kk _m_e_m Next argument is memory image (default, /ddeevv/mmeemm)
-ll Print long format
-mm Print scheduling information
-nn No header line
-rr Give the real size of the process
-tt Print CPU times
-ww Wide column format (132 columns instead of default 80)
-xx Print processes with no controlling tty
#pushd
ppuusshhdd -- Push an item onto the directory stack
ppuusshhdd [_d_i_r_e_c_t_o_r_y_0 ... _d_i_r_e_c_t_o_r_y_N]
sshh only.
#pwd
ppwwdd -- Print the name of the current directory
ppwwdd
#qfind
qqffiinndd -- Quickly find all files with a given name
qqffiinndd [-aaddpp] _n_a_m_e ...
qqffiinndd [-bb]
_O_p_t_i_o_n_s:
-aa All: search for files or directories
-bb Build file data base
-dd Search for directories only
-pp Partial name matching
Run as rroooott when using -bb to find everything.
#quot
qquuoott -- Summarize file-system usage
qquuoott [ -cc ] [ -ff ] [ -nn ] [ -tt ] _f_i_l_e_s_y_s_t_e_m
_O_p_t_i_o_n_s:
-cc Print file size, number of files of size, and cumulative total
blocks up to size
-ff Print number of files plus number of blocks per user
-nn Input (i-number, file system) pairs one per line; output owners
and file names (e.g.: nncchheecckk ffss | ssoorrtt +00nn | qquuoott -nn ffss)
-tt Print totals (where applicable)
Options -cc and -nn are disjoint from other options. Only the superuser rroooott can
run qquuoott.
#ramdisk
rraammddiisskk -- Script to create a RAM-disk
/uussrr/bbiinn/rraammddiisskk
#ranlib
rraannlliibb -- Create index for object library
rraannlliibb _l_i_b_r_a_r_y ...
#rc
rrcc -- Perform standard maintenance chores
/eettcc/rrcc
#read
rreeaadd -- Assign values to shell variables
rreeaadd _n_a_m_e ...
Reads a line from stdin and assign each token to corresponding shell variable
_n_a_m_e. The shell executes rreeaadd directly.
#readonly
rreeaaddoonnllyy -- Mark a shell variable as read only
rreeaaddoonnllyy
#reboot
rreebboooott -- Reboot the COHERENT system
/eettcc/rreebboooott [ -pp ]
_O_p_t_i_o_n:
-pp Prompt user if she really wishes to reboot
#ref
rreeff -- Display a C function header
rreeff _f_u_n_c_t_i_o_n
#restor
rreessttoorr -- Restore file system
rreessttoorr _c_o_m_m_a_n_d [_d_u_m_p__d_e_v_i_c_e] [_f_i_l_e_s_y_s_t_e_m] [_f_i_l_e ...]
_O_p_t_i_o_n_s:
ff Next argument names the dump device
rr Mass restore (also RR)
tt Print taken and since dates of the dump
vv Verbose (print commentary during mass restore)
xx Selective extract of argument files (also `X')
#rev
rreevv -- Print text backwards
rreevv [_f_i_l_e ...]
#rm
rrmm -- Remove files
rrmm [ -ffiirrttvv ] _f_i_l_e ...
_O_p_t_i_o_n_s:
-ff Force: remove unwritable files, suppress error messages and
prompts
-ii Ask before removing each file
-rr Recursively remove entire directory structure
-tt Test: perform all checks but do not remove files
-vv Verbose: report the disposition of each file
#rmail
rrmmaaiill -- Receive UUCP mail
rrmmaaiill [-LLllRRrr] -qq _n_u_m -uu _u_u_x_f_l_a_g_s _a_d_d_r_e_s_s ...
_O_p_t_i_o_n_s:
-LL Send all addresses to the local mailer for processing
-ll Send a domain address to the local mailer for processing
-qq _n_u_m Reset the queueing threshold to _n_u_m
-RR Reroute UUCP paths
-rr Route the first component of a UUCP path in addition to routing
domain addresses
-uu _u_u_x_f_l_a_g_s
Pass _u_u_x_f_l_a_g_s to uuuuxx
#rmdir
rrmmddiirr -- Remove directories
rrmmddiirr [ -ff ] _d_i_r_e_c_t_o_r_y ...
_O_p_t_i_o_n:
-ff Force: remove a file without interactive checking
#rubik
rruubbiikk -- Play Rubik's cube
/uussrr/ggaammeess/rruubbiikk
#sa
ssaa -- Print a summary of process accounting
ssaa [-aabbccjjllmmnnrrssttuu] [-vv _N] [_f_i_l_e]
_O_p_t_i_o_n_s:
-aa Commands seen once or unprintable called ***ootthheerr
-bb Sort by average CPU time per call
-cc Print CPU time as percentage of all CPU time used
-jj Print average times per call, not totals
-ll Separate user and system times
-mm Information per user, not per command
-nn Sort by number of calls
-rr Reverse sort
-ss Condense the information
-tt Print CPU time as percentage of real time
-uu Print user and command directly from raw file
-vv_N If called no more than _N times, put it into **jjuunnkk**
The default _f_i_l_e is /uussrr/aaddmm/aacccctt.
#scat
ssccaatt -- Print text files one screenful at a time
ssccaatt [ [_o_p_t_i_o_n ...] [_f_i_l_e ... ] ] ...
_O_p_t_i_o_n_s:
-11 Do not stop at EOF if exactly one file specified
-bb_n Begin output at line _n
-cc Mark control characters (overrides -tt)
-ccss Like -cc, but map space to underscore `_', and prefix underscore
with `\'
-cctt Like -cc, but map tabs to spaces
-iinn Skip _n columns on output
-llnn Set screen length to _n lines
-nn Number input lines
-rr Remote; no paging
-ss Squash empty lines
-SS_n Seek _n bytes into input before processing
-tt Truncate lines to line length (default, wraparound)
-ww_n Set screen width to _n columns
-xx Expand tabs
_C_o_m_m_a_n_d_s:
<rreettuurrnn> Next page
<ssppaaccee> Next line
/ Next half page
ff Print file names and line number
nn Next file
qq Quit
#sed
sseedd -- Stream editor
sseedd [ -nn ] [-ee _c_o_m_m_a_n_d] [-ff _s_c_r_i_p_t] ... _f_i_l_e ...
_O_p_t_i_o_n_s:
-ee Direct command follows
-ff File name of command script follows
-nn No implicit output
#set
sseett -- Set shell option flags and positional parameters
sseett [-cceeiikknnssttuuvvxx [_n_a_m_e ...] ] (Bourne shell)
sseett [[+-]aaeeffhhkkmmnnuuvvxx] [[+-]oo _n_a_m_e] (Korn shell)
_O_p_t_i_o_n_s:
-aa Automatically export all new variables (kksshh)
-cc _s_t_r_i_n_g Read commands from _s_t_r_i_n_g (sshh)
-ee Exit on any error
-ff Noglob: Don't expand file names (kksshh)
-hh Automatically add all commands to hash table (kksshh)
-ii Shell is always interactive (sshh)
-kk Place all keyword arguments into environment (sshh)
-kk Recognize variables anywhere in command (kksshh)
-mm Enable job control (kksshh)
-nn Read commands but do not execute
-oo _o_p_t_i_o_n Set _o_p_t_i_o_n (kksshh)
-ss Read commands from stdin; write to stderr (sshh)
-tt Read one command rather than entire file (sshh)
-uu If variable is blank, report error
-vv Print each line as it is read
-xx Print each command as it's executed
- Cancel -vv and -xx options (sshh)
With kksshh, prefixing an option with `+' turns it on; prefixing it with `-' turns
it off.
#sh
sshh -- The Bourne shell
sshh [-cceeiikknnssttuuvvxx] _t_o_k_e_n ...
_O_p_t_i_o_n_s:
-cc _c_m_d_s Read commands from _c_m_d_s
-ee Exit on any error if noninteractive
-ii Interactive even if no tty attached
-kk Place all keyword args into global environment
-nn Read commands but do not execute them
-ss Read commands from stdin, write output to stderr
-tt Read and execute one command only
-uu Report error if actual value of shell variable is null
-vv Print each line as read
-xx Print each command and argument as executed
- Cancel -vv and -xx options
The following reserved tokens may not be used in the first position of the
command unless quoted:
ccaassee ddoo ddoonnee eelliiff eellssee ffii ffoorr iinn tthheenn uunnttiill wwhhiillee { } ( )
If the first token is not reserved, it is treated as the name of a command.
The remaining tokens are treated as arguments. The characters * ? [ ] specify
patterns that match file names. To quote characters or strings, these escape
characters are provided:
'...' "..." \
Each _t_o_k_e_n, unless quoted, is checked for substitutions.
#shift
sshhiifftt -- Shift positional parameters
sshhiifftt
The shell executes sshhiifftt directly.
#shutdown
sshhuuttddoowwnn -- Shut down the COHERENT system
/eettcc/sshhuuttddoowwnn
#size
ssiizzee -- Print size of an object file
ssiizzee [_f_i_l_e ...]
#sleep
sslleeeepp -- Stop executing for a specified time
sslleeeepp _s_e_c_o_n_d_s
#smail
ssmmaaiill -- Send UUCP mail
ssmmaaiill [-AAccddLLllRRrrvv] -aa _a_l_i_a_s_f_i_l_e -FF _a_d_d_r_e_s_s -HH [_h_o_s_t_d_o_m_a_i_n] \
-hh [_h_o_s_t] -mm _n_u_m -nn [_n_a_m_e_l_i_s_t] -pp _p_a_t_h_f_i_l_e \
-qq _n_u_m -uu _u_u_x_f_l_a_g_s _a_d_d_r_e_s_s ...
_O_p_t_i_o_n_s:
-AA Print the resolved UUCP addresses; do not collect mail
-aa _a_l_i_a_s_f_i_l_e
Read _a_l_i_a_s_f_i_l_e
-cc Check /uussrr/lliibb/mmaaiill/ppaatthhss for the cost of mailing a message to a
given host
-dd Give a verbose description; do not invoke other mailers
-FF _a_d_d_r_e_s_s
Use _a_d_d_r_e_s_s on the FFrroomm: line
-HH _h_o_s_t_d_o_m_a_i_n
Set the host's domain
-hh _h_o_s_t_n_a_m_e
Set a _h_o_s_t_n_a_m_e
-LL Send all addresses to the local mailer for processing
-ll Send a domain address to the local mailer for processing
-mm _n_u_m Send no more than _n_u_m jobs to uuuuxx
-nn [_n_a_m_e_l_i_s_t]
Use name-list style aliasing
-pp _p_a_t_h_f_i_l_e
Read _p_a_t_h_f_i_l_e instead of /uussrr/lliibb/mmaaiill/ppaatthhss
-qq _n_u_m Set the queuing threshold to _n_u_m
-RR Reroute UUCP paths
-rr Route the first component of a UUCP path in addition to routing
domain addresses
-uu _u_u_x_f_l_a_g_s
Pass _u_u_x_f_l_a_g_s to uuuuxx
-vv Give verbose description, but invoke other mailers
#sort
ssoorrtt -- Sort lines of text
ssoorrtt [-bbccddffiimmnnrruu] [-tt _c] [-oo _o_u_t_f_i_l_e] [-TT _d_i_r] [+_b_e_g[-_e_n_d]][_f_i_l_e ...]
_O_p_t_i_o_n_s:
-cc Check if input is already ordered
-mm Merge already-sorted input files
-oo _n_a_m_e Place output in _n_a_m_e, not stdout
-tt_c Tab character is _c
-TT _d_i_r Use _d_i_r for temporary files
-uu Output only records with unique keys
_K_e_y _o_p_t_i_o_n_s:
-bb Skip leading blanks in fields
-dd Dictionary ordering for keys
-ff Fold upper case into lower case in key comparison
-ii Ignore control characters in key comparison
-nn Numeric comparison
-rr Reverse sort ordering
_P_o_s_i_t_i_o_n:
+_m._n_f Key starts _m fields into record and _n characters into that
field; _f may contain optional flags from key options above which
apply only to that positional
-_m._n_f Optional ending position of key (same form as above)
If no _f_i_l_e is given, sort stdin.
#spell
ssppeellll -- Find spelling errors
ssppeellll [-aa][-bb][_f_i_l_e ...]
_O_p_t_i_o_n_s:
-aa Use American variant of the dictionary (default)
-bb Use British variant of the dictionary
#split
sspplliitt -- Split a text file into smaller files
sspplliitt [-_n_l_i_n_e_s][-cc_c_o_u_n_t][_i_n_f_i_l_e [_o_u_t_f_i_l_e] ]
If _i_n_f_i_l_e _i_s `-' _o_r _n_o _i_n_f_i_l_e, stdin is read. _o_u_t_f_i_l_e defaults to xx. _n_l_i_n_e_s
is number of lines for text files, _c_o_u_n_t is the character count for binary
files.
#srcpath
ssrrccppaatthh -- Find source files
ssrrccppaatthh [-aaww] [-pp _p_a_t_h] _f_i_l_e_n_a_m_e _p_a_t_t_e_r_n ...
_O_p_t_i_o_n_s:
-aa Disable shadowing: print all instances of file it finds along
SSRRCCPPAATTHH, not just first
-pp _p_a_t_h Use _p_a_t_h instead of SSRRCCPPAATTHH
-ww Print warning when you lack permission to read file or directory
#strings
ssttrriinnggss -- Print all character strings from a file
ssttrriinnggss [-ddooppxx] [-_l_e_n_g_t_h] [_f_i_l_e ... ]
_O_p_t_i_o_n_s:
-dd Print offset of each string in decimal
-oo Print offset of each string in octal
-pp Mask out the parity bit
-xx Print offset of each string in hexadecimal
#strip
ssttrriipp -- Strip tables from executable file
ssttrriipp -ddrrss _f_i_l_e [...]
_O_p_t_i_o_n_s:
-dd Keep debug information
-rr Keep relocation information
-ss Keep symbols
#stty
ssttttyy -- Set/print terminal modes
ssttttyy [_o_p_t_i_o_n ...]
_O_p_t_i_o_n_s:
99660000 Baud rate: any valid terminal speed accepted
00 Hang up phone immediately
[bbrreeaakk|eeooff|eerraassee|iinntteerrrruupptt|kkiillll|qquuiitt|ssttaarrtt|ssttoopp] _c
Set specified character to _c
aallll Display all modes
ccbbrreeaakk Enable break after every input character
-ccbbrreeaakk Disable break after every input character
ccrrtt Enable crt character erasing
-ccrrtt Disable crt character erasing
eecchhoo Enable input character echoing
-eecchhoo Disable input character echoing
eevveenn Enable even parity
-eevveenn Disable even parity
eexxccll Enable exclusive use
-eexxccll Disable exclusive use
fflluusshh Flush input queues
-fflluusshh Do not flush input queues
hhuupp Enable hang up on last close
-hhuupp Disable hang up on last close
nnll Disable newline mapping
-nnll Enable newline mapping
oodddd Enable odd parity
-oodddd Disable odd parity
pprriinntt Print terminal attributes
rraaww Enable raw mode
-rraaww Disable raw mode
ssaannee Set terminal to a known state
ttaabbss Disable tab expansion
-ttaabbss Enable tab expansion
ttaannddeemm Enable tandem (start/stop) mode
-ttaannddeemm Disable tandem (start/stop) mode
If no _o_p_t_i_o_n is specified, ssttttyy prints the modes of the standard-output device
on stderr.
#su
ssuu -- Substitute user id, become superuser
ssuu [_u_s_e_r [_c_o_m_m_a_n_d] ]
#sum
ssuumm -- Print checksum of a file
ssuumm [_f_i_l_e ...]
#sync
ssyynncc -- Flush system buffers
ssyynncc
#tail
ttaaiill -- Print the end of a file
ttaaiill [+_n[bbccffll]] [_f_i_l_e]
ttaaiill [-_n[bbccffll]] [_f_i_l_e]
_O_p_t_i_o_n_s:
+_n _n counts from beginning of file
-_n _n counts from end of file
bb _n is in blocks
cc _n is in characters (bytes)
ff Open tail of file, then display new material as it is added to
the file. File remains open until you type interrupt (usually
<ccttrrll-CC>).
ll _n is in lines (default)
#tar
ttaarr -- V7 tape archive manager
ttaarr [ccrrttuuxx[00-77bbffllmmvvwwUU] [_b_l_o_c_k_s] [_a_r_c_h_i_v_e] _f_i_l_e ...
_D_i_r_e_c_t_i_v_e_s:
cc Create a new archive, overwriting any old contents
rr Replace (append) the named files in the archive
tt Write a table of contents of the archive to stdout
uu Update the archive (replace mode)
xx Extract the named files from the archive
_O_p_t_i_o_n_s:
00-77 A single octal digit specifies a tape unit
BB Next argument is the blocking factor
ff Next argument is the archive name
ll Report broken links
mm Ignore the mmttiimmee for each extracted file
UU Tape written on a non-COHERENT system
vv Verbose flag
ww Interactive mode
#tee
tteeee -- Branch pipe output
tteeee [ -aa ] [ -ii ] [ _f_i_l_e ...]
_O_p_t_i_o_n_s:
-aa Append to each output _f_i_l_e
-ii Ignore interrupts
#termcap
tteerrmmccaapp -- Terminal-description language
/eettcc/tteerrmmccaapp
#terminfo
tteerrmmiinnffoo -- terminal description language
/uussrr/lliibb/tteerrmmiinnffoo
#test
tteesstt -- Evaluate conditional expression
tteesstt _e_x_p_r_e_s_s_i_o_n ...
_O_p_t_i_o_n_s:
_e_x_p_1 -aa _e_x_p_2
Both expressions are true
-bb _f_i_l_e _f_i_l_e is block-special (kksshh)
-cc _f_i_l_e _f_i_l_e is character-special (kksshh)
-dd _f_i_l_e _f_i_l_e is a directory
_f_i_l_e_1 -eeff _f_i_l_e_2
Files are identical (kksshh)
_n_1 -eeqq _n_2 Numbers are equal
-ff _f_i_l_e _f_i_l_e exists and is not a directory
-gg _f_i_l_e _f_i_l_e has sseettggiidd bit set (kksshh)
_n_1 -ggee _n_2 _n_1 is greater than or equal to _n_2
_n_1 -ggtt _n_2 _n_1 greater than _n_2
-kk _f_i_l_e _f_i_l_e has sticky bit set (kksshh)
-LL _f_i_l_e _f_i_l_e is a symbolic link (kksshh)
_n_1 -llee _n_2 _n_1 is less than or equal to _n_2
_n_1 -lltt _n_2 _n_1 is less than _n_2
-nn _s_t_r_i_n_g ssttrriinngg has non-zero length
_n_1 -nnee _n_2 _n_1 does not equal _n_2
_f_1 -nntt _f_2 _f_1 is newer than _f_2 (kksshh)
_e_x_p_1 -oo _e_x_p_2
Either _e_x_p_1 or _e_x_p_2 is true
_f_1 -oott _f_2 _f_1 is older than _f_2 (kksshh)
-pp _f_i_l_e _f_i_l_e is a named pipe (kksshh)
-rr _f_i_l_e _f_i_l_e is readable
-ss _f_i_l_e _f_i_l_e exists and has nonzero length
-tt [_f_d] _f_d describes a terminal
-uu _f_i_l_e _f_i_l_e has sseettuuiidd set (kksshh)
-ww _f_i_l_e _f_i_l_e is writable
-xx _f_i_l_e _f_i_l_e is executable (kksshh)
-zz _s_t_r_i_n_g _s_t_r_i_n_g has zero length
_s_t_r_i_n_g _s_t_r_i_n_g has non-zero length
_s_1 = _s_2 _s_1 equals string _s_2
! _e_x_p Negate logical value of _e_x_p
_s_1 != _s_2 String _s_1 does not equal _s_2
(_e_x_p) Parentheses group expressions
#tic
ttiicc -- Compile a terminfo description
ttiicc [-vv[_n]] _s_o_u_r_c_e_f_i_l_e
_O_p_t_i_o_n:
-vv Verbose: Include debugging and tracing information.
#time
ttiimmee -- Time the execution of a command
ttiimmee [_c_o_m_m_a_n_d]
#times
ttiimmeess -- Print total user and system times
ttiimmeess
#touch
ttoouucchh -- Update modification time of a file
ttoouucchh [ -cc ] _f_i_l_e ...
_O_p_t_i_o_n:
-cc Do not create _f_i_l_e if it does not exist
The shell executes ttoouucchh directly.
#tr
ttrr -- Translate characters
ttrr [-ccddss] _s_t_r_i_n_g_1 [_s_t_r_i_n_g_2]
_O_p_t_i_o_n_s:
-cc Complement the characters in _s_t_r_i_n_g_1
-dd Delete characters found in _s_t_r_i_n_g_1 (_n_o _s_t_r_i_n_g_2 needed)
-ss Squeeze multiple output mappings onto one character
Both strings may contain ranges. Characters may have form \_n_n_n.
#trap
ttrraapp -- Execute command on receipt of signal
ttrraapp [_c_o_m_m_a_n_d] [_n ...]
The shell executes _c_o_m_m_a_n_d on receipt of signal _n .... If _c_o_m_m_a_n_d omitted, the
shell resets traps on given signals to original values. If _c_o_m_m_a_n_d is a null
string, given signals are ignored. If _n is zero, the shell executes _c_o_m_m_a_n_d
when it exits. With no arguments, it prints currently set traps. The shell
executes trap directly.
#troff
ttrrooffff -- Extended text-formatting language
ttrrooffff [_o_p_t_i_o_n ...] [_f_i_l_e ...]
_O_p_t_i_o_n_s:
-DD Display available fonts
-ff _n_a_m_e Write temporary file in file _n_a_m_e
-ii Read stdin after each _f_i_l_e has been read
-kk Keep temporary file
-ll Landscape mode
-mm_n_a_m_e Read macro package /uussrr/lliibb/ttmmaacc._n_a_m_e
-nn_N Number first page of output _N (default, one)
-pp Produce PostScript output
-rr_a_N Set number register _a to value _N
-rr_a_b_N Set number register _a_b to value _N; for obvious reasons, _a_b
cannot contain a digit
-xx Do not eject to bottom of final page
#true
ttrruuee -- Unconditional success
ttrruuee
#tsort
ttssoorrtt -- Topological sort
ttssoorrtt [_f_i_l_e]
#ttt
tttttt -- Play 3-D tic-tac-toe
/uussrr/ggaammeess/tttttt
#tty
ttttyy -- Print the user's terminal name
ttttyy
#ttystat
ttttyyssttaatt -- Get terminal status
/eettcc/ttttyyssttaatt [ -dd ] _p_o_r_t
_O_p_t_i_o_n:
-dd Print status of _p_o_r_t
Returns exit status 1 if specified port is enabled, 0 if disabled. Prints
nothing unless -dd option specified.
#typeset
ttyyppeesseett -- Set/list variables and their attributes
ttyyppeesseett
ttyyppeesseett [+-]ffrr
ttyyppeesseett [ iirrxx ] _v_a_r_i_a_b_l_e=_v_a_l_u_e
_F_i_r_s_t _f_o_r_m: List all variables and their attributes
_S_e_c_o_n_d _f_o_r_m:
+ff List functions
-ff List functions plus values
+rr List read-only variables
-rr List read-only variables plus values
_T_h_i_r_d _f_o_r_m: Set _v_a_r_i_a_b_l_e to equal _v_a_l_u_e
ii Store _v_a_l_u_e as an integer
rr List read-only variables
xx Export _v_a_r_i_a_b_l_e=_f_R _t_o _e_n_v_i_r_o_n_m_e_n_t
kksshh only.
#typo
ttyyppoo -- Detect possible typographical and spelling errors
ttyyppoo [-nnrrss][_f_i_l_e ...]
_O_p_t_i_o_n_s:
-nn Do not use built-in English statistics or dictionary
-rr Raw; do not remove nroff commands from the input
-ss Produce _d_i_g_r_a_m_s and _t_r_i_g_r_a_m_s files (maintenance only)
#umask
uummaasskk -- Set the file-creation mask
uummaasskk [_m_a_s_k]
The shell executes uummaasskk directly.
#umount
uummoouunntt -- Unmount file system
/eettcc/uummoouunntt _s_p_e_c_i_a_l
#unalias
uunnaalliiaass -- Remove an alias
uunnaalliiaass _a_l_i_a_s ...
kksshh only. kksshh only.
#uncompress
uunnccoommpprreessss -- Uncompress a compressed file
uunnccoommpprreessss [ -ww _t_m_p_f_i_l_e ] [ _f_i_l_e ... ] (COHERENT 286)
uunnccoommpprreessss [ _f_i_l_e ... ] (COHERENT 386)
_O_p_t_i_o_n:
-ww Use _t_m_p_f_i_l_e as the workfile (default, /ddeevv/rraamm11) COHERENT 286
only.
#uniq
uunniiqq -- Remove/count repeated lines in a sorted file
uunniiqq [-ccdduu] [-_n] [+_n] [_i_n_f_i_l_e[_o_u_t_f_i_l_e]]
_O_p_t_i_o_n_s:
-cc Print duplication count with lines
-dd Print only duplicated lines
-nn Skip _n fields during comparison
+nn Skip _n characters (after skipping fields)
-uu Print only non-repeated lines
#units
uunniittss -- Convert measurements
uunniittss [ -uu ]
_O_p_t_i_o_n:
-uu Update binary file only
uunniittss works interactively.
#unmkfs
uunnmmkkffss -- Construct a prototype file system
uunnmmkkffss [-_p_r_e_f_i_x] _d_i_r_e_c_t_o_r_y _n_b_l_o_c_k_s [_f_i_l_e]
#until
uunnttiill -- Execute commands repeatedly
uunnttiill _s_e_q_u_e_n_c_e_1 [ ddoo _s_e_q_u_e_n_c_e_2 ] ddoonnee
Both ddoo and ddoonnee must be the first token on a line or preceded by `;'. The
shell executes uunnttiill directly.
#update
uuppddaattee -- Update file systems periodically
/eettcc/uuppddaattee
update -- Update file systems periodically Usage: /etc/update
#ustar
uussttaarr -- Process tape archives
uussttaarr -cc[vvww] [-ff _a_r_c_h_i_v_e] _f_i_l_e ...
uussttaarr -rr[vvww] [-ff _a_r_c_h_i_v_e] _f_i_l_e ...
uussttaarr -tt[vv] [-ff _a_r_c_h_i_v_e]
uussttaarr -xx[llmmoovvww] [-ff _a_r_c_h_i_v_e] [_f_i_l_e ...]
_O_p_t_i_o_n_s:
-cc Create a new archive
-rr Append _f_i_l_e into _a_r_c_h_i_v_e
-tt Print table of contents for _a_r_c_h_i_v_e
-xx Extract _f_i_l_e from _a_r_c_h_i_v_e
_M_o_d_i_f_i_e_r_s:
-ff Next argument names output archive
-ll Print error message if all links cannot be resolved (cc or rr
commands only)
-mm Do not restore modification time (invalid with tt)
-oo Give extracted files your user and group identifiers (xx command
only)
-vv Verbose option
-ww Wait option: wait for confirmation before continuing
#uucheck
uuuucchheecckk -- Sanity-check the UUCP system
uuuucchheecckk [ -ffssvv ]
_O_p_t_i_o_n_s:
-ff Attempt to ``fix'' any problems found
-ss Run in ``silent'' mode, generating no output
-vv Run in ``verbose'' mode, generating extra output
#uucico
uuuucciiccoo -- Transmit data to or from a remote site
/uussrr/lliibb/uuuuccpp/uuuucciiccoo [ -cc_s_i_t_e ] [ -rr11 ] [ -ss_s_i_t_e ] [ -ssaallll ] [ -SS_s_i_t_e ] [ -xx_l_e_v_e_l ]
_O_p_t_i_o_n_s:
-cc_s_i_t_e Poll _s_i_t_e only if a file is queued for transmission to it
-rr00 Act as slave in polling process
-rr11 Act as master in polling process; default
-ss_s_i_t_e Name _s_i_t_e as a place to be polled
-ssaallll Poll all sites automatically
-SS_s_i_t_e Poll _s_i_t_e unconditionally
-xx_l_e_v_e_l Run in debug mode; _l_e_v_e_l sets level of debugging, from 1 to 10
#uucp
uuuuccpp -- Ready files for transmission to other systems
uuuuccpp [ -ccCCddffmmrr ] [-nn_u_s_e_r] [-ss _d_i_r] [-xx_n] _s_o_u_r_c_e ... _d_e_s_t
_O_p_t_i_o_n_s:
-cc Do not copy source to spool directory; rather use the file
itself (default)
-CC Copy source file to spool directory
-dd Create directories as required on destination
-ff Do not make intermediate directories.
-mm Send mail to requester when file is sent
-nn_u_s_e_r Notify _u_s_e_r (on destination system) when file received
-rr Spool transfer request, do not initiate uuuucciiccoo
-xx_l_e_v_e_l Assign debug _l_e_v_e_l (0 to 9)
#uucpname
uuuuccppnnaammee -- Set the system's UUCP name
/eettcc/uuuuccppnnaammee
#uudecode
uuuuddeeccooddee -- Decode a binary file sent from a remote system
uuuuddeeccooddee [ _f_i_l_e ]
#uuencode
uuuueennccooddee -- Encode a binary file for transmission
uuuueennccooddee [ _s_o_u_r_c_e ] _r_e_m_o_t_e_d_e_s_t
#uuinstall
uuuuiinnssttaallll -- Install UUCP
uuuuiinnssttaallll
#uulog
uuuulloogg -- Examine UUCP operations
uuuulloogg [ -ffxx ] [ _s_y_s_t_e_m ]
_O_p_t_i_o_n_s:
-ff Show UUCP activity as it is logged; like ttaaiill -ff
-xx Display logs for uuuuxxqqtt instead of uuuucciiccoo
#uumvlog
uuuummvvlloogg -- Archive UUCP log files
uuuummvvlloogg _d_a_y_s
_O_p_t_i_o_n_s:
_d_a_y_s Number of days for which logs should be kept
#uuname
uuuunnaammee -- List UUCP names of known systems
uuuunnaammee [ -ll ]
_O_p_t_i_o_n:
-ll Print name of the local system
#uurmlock
uuuurrmmlloocckk -- Remove UUCP lock files
uuuurrmmlloocckk
#uutouch
uuuuttoouucchh -- Touch a file to trigger uucico poll
uuuuttoouucchh _s_y_s_t_e_m
#uux
uuuuxx -- Execute a command on a remote system
uuuuxx [-aa _u_s_e_r] [-rrnnppzz] _c_o_m_m_a_n_d-_s_t_r_i_n_g
_O_p_t_i_o_n_s:
-aa _u_s_e_r Name _u_s_e_r as requester
-gg _l Set importance of transmission; _l is a single ASCII character
-nn Suppress notification of command completion
-pp Input to uuuuxx is a pipe or input redirection
-rr Queue uuuuxx request; do not invoke uuuucciiccoo
-zz Notify requestor when _c_o_m_m_a_n_d-_l_i_n_e succeeds
#uuxqt
uuuuxxqqtt -- Execute commands requested by a remote system
uuuuxxqqtt
#vi
vvii -- Clone of Berkeley-style screen editor
vvii [ _o_p_t_i_o_n_s ] [ +_c_m_d ] [ _f_i_l_e_1 ... _f_i_l_e_2_7 ]
_O_p_t_i_o_n_s:
-ee Begin in colon-command mode
-ii Begin in input mode
-rr Recover a previous edit
-RR Read-only mode
-tt _t_a_g Begin editing at _t_a_g
-mm Use in error-handling mode
-vv Begin in visual-command mode
+_c_o_m_m_a_n_d Execute _c_o_m_m_a_n_d before editing
#view
vviieeww -- Screen-oriented viewing utility
vviieeww _f_i_l_e_1 ... _f_i_l_e_2_7
#virec
vviirreecc -- Recover the modified version of a file after a crash
vviirreecc [-dd _t_m_p_d_i_r] _t_e_x_t_f_i_l_e_n_a_m_e...
vviirreecc </ttmmpp/eellvv_X_X_X
#wait
wwaaiitt -- Await completion of background process
wwaaiitt [_p_i_d]
_p_i_d identifies the process whose completion is awaited. If no _p_i_d is given,
wwaaiitt awaits completion of all background processes. The shell executes wwaaiitt
directly.
#wall
wwaallll -- Send a message to all logged-in users
/eettcc/wwaallll
#wc
wwcc -- Count words, lines, and characters in text files
wwcc [-ccllww] [_f_i_l_e...]
_O_p_t_i_o_n_s:
-cc Print count of characters
-ll Print count of lines
-ww Print count of words
If no _f_i_l_e is given, wwcc reads stdin; if more than one _f_i_l_e is given, it also
prints a total.
#whence
wwhheennccee -- List a command's type
wwhheennccee [-vv] _c_o_m_m_a_n_d ...
kksshh only.
#whereis
wwhheerreeiiss -- Locate source, binary, and manual files
wwhheerreeiiss [-bbmmrrssuu] [-BBMMSS _d_i_r ... -ff] _n_a_m_e ...
_O_p_t_i_o_n_s:
-bb Search only for for binary files
-mm Search only for manual pages
-rr Search each _d_i_r downwardly recursively
-ss Search only for source files
-uu Search for unusual files
-BB Search each _d_i_r for binary files
-MM Search each _d_i_r for manual pages
-RR Search each _d_i_r downwardly recursively
-SS Search each _d_i_r for source files
-ff Terminate directory list begun by -BBMMRRSS options
#which
wwhhiicchh -- Locate executable files
wwhhiicchh _c_o_m_m_a_n_d ...
#while
wwhhiillee -- Execute commands repeatedly
wwhhiillee _s_e_q_u_e_n_c_e_1 [ddoo _s_e_q_u_e_n_c_e_2] ddoonnee
Both ddoo and ddoonnee must be the first token on a line or preceded by `;'. The
shell executes wwhhiillee directly.
#who
wwhhoo -- Print who is logged in
wwhhoo [_f_i_l_e] [aamm ii]
#write
wwrriittee -- Converse with another user
wwrriittee _u_s_e_r [ _t_t_y ]
Name the _t_t_y if _u_s_e_r is logged in on more than one port.
#yacc
yyaacccc -- Parser generator
yyaacccc [_o_p_t_i_o_n ...] _f_i_l_e
cccc yy.ttaabb.cc [-llyy]
_O_p_t_i_o_n_s:
-dd Enable debugging output (implies -vv)
-hhddrr Next argument is name of header file (default, yy.ttaabb.hh)
-iitteemmss AAllllooww _N items per state.
-ll Next argument is name of listfile (default, yy.oouuttppuutt)
sspprroodd _N Allow _N symbols per production (default, 20)
-sstt Print statistics on standard output
-vv Verbose (extra output in listfile)
After each of the following, the next argument is a number to reset table size:
-nntteerrmmss Nonterminal symbols (default, 100)
-pprrooddss Productions or rules (default, 350)
-ssttaatteess States (default, 300)
-tteerrmmss Terminal symbols (default, 300)
-ttyyppeess Types (default, 10)
#yes
yyeess -- Print infinitely many responses
yyeess [ _s_t_r_i_n_g ]
#zcat
zzccaatt -- Concatenate a compressed file
zzccaatt [-ww _t_m_p_f_i_l_e ] [ _f_i_l_e ... ] (COHERENT 286)
zzccaatt [ _f_i_l_e ... ] (COHERENT 386)
-ww _t_m_p_f_i_l_e
Use _t_m_p_f_i_l_e as the workfile (default, /ddeevv/rraamm11). COHERENT 286
only.
This archive runs on limited infrastructure. Preserving old code on modern bandwidth. Automated agents are requested to crawl responsibly.