File:  [MW Coherent from dump] / coherent / f / etc / helpfile
Revision 1.1.1.1 (vendor branch): download - view: text, annotated - select for diffs
Wed May 29 04:56:39 2019 UTC (7 years, 3 months ago) by root
Branches: MarkWilliams, MAIN
CVS tags: relic, HEAD
coherent

#ac
aacc -- Summarize login accounting information

aacc [ -ddpp ] [ -ww _w_f_i_l_e ][ _u_s_e_r_n_a_m_e ... ]

_O_p_t_i_o_n_s:
     -dd        Itemize for each midnight-midnight period
     -pp        Itemize by individual users
     -ww _w_t_m_p   Obtain raw statistics from _w_t_m_p rather than /uussrr/aaddmm/wwttmmpp

If users are specified, only they are considered.
#accton
aaccccttoonn -- Enable/disable process accounting

/eettcc/aaccccttoonn [ _f_i_l_e ]

Normally _f_i_l_e is /uussrr/aaddmm/aacccctt.  If no _f_i_l_e argument is included, disable
process accounting.
#alias
aalliiaass -- Set an alias

aalliiaass [_n_a_m_e[=_v_a_l_u_e ...]]

kksshh only.
#aliases
aalliiaasseess -- File of users' aliases

/uussrr/lliibb/mmaaiill/aalliiaasseess
$HHOOMMEE/.aalliiaasseess
$HHOOMMEE/.ffoorrwwaarrdd

#ar
aarr -- The librarian/archiver

aarr _o_p_t_i_o_n [_m_o_d_i_f_i_e_r][_p_o_s_i_t_i_o_n] _a_r_c_h_i_v_e [_m_e_m_b_e_r ...]

_O_p_t_i_o_n_s:
     dd         Delete given members
     mm         Move member to indicated position (default, end)
     pp         Print members
     qq         Quick append, put members at end with no checking
     rr         Replace each member specified in the archive
     tt         Print a table of members (default, all)
     xx         Extract the specified members (default, all)
_M_o_d_i_f_i_e_r_s:
     aa         Place new member after _p_o_s_i_t_i_o_n in archive
     bb         Place new member before _p_o_s_i_t_i_o_n in archive
     cc         Suppress message when new archive is created
     ii         Insert new member before _p_o_s_i_t_i_o_n in archive
     kk         Preserve modify time of file (with options rr, qq, or xx)
     ll         Use current directory for temporaries (default, /ttmmpp)
     ss         Update ranlib header even if not present (with options rr or mm)
     uu         Update: replace members only if newer than those in archive
     vv         Print extra information when used with certain options
#as 286
aass 228866 -- i80286 assembler

aass [-ggllxx] [ -oo_f_i_l_e ] _f_i_l_e ...

_O_p_t_i_o_n_s:
     -gg        Make all undefined symbols global
     -ll        Output listing to standard output
     -oo _d_e_s_t   Rename output file _d_e_s_t (default, ll.oouutt)
     -xx        Strip local symbols from symbol table
#as 386
aass 338866 -- i80386 assembler

aass [-oo _o_u_t_f_i_l_e] [-bbffggllnnppwwxxXX] _i_n_f_i_l_e

_O_p_t_i_o_n_s:
     -bb        Reverse bracket sense; that is, use () for expressions and []
               for code.
     -ff        Reverse order of operands from UNIX assembler form to that of
               Intel documentation or 80286 version of aass.
     -gg        Make undefined symbols .gglloobbll.
     -ll        Generate output listing.
     -nn        Turn off the insertion of nnoopps to correct 80386 errors.
     -oo _o_u_t_f_i_l_e
               Name the file into which the relocatable object is written
     -pp        Don't use `%' on register names; e.g., use aaxx, not %aaxx.
     -QQ        Quiet: Suppress all error messages, no matter how awful an error
               they indicate
     -ww        Disable warning messages.
     -xx        Remove all non-global symbols from the common symbol output.
     -XX        Remove all non-global symbols starting with .LL from the common
               symbol output.

Options and file names can be interspersed on the command line.

The 80386 version of aass assembles files written in the 80286 dialect of aass or
UNIX-style assembly language.  It generates relocatable object modules that can
be linked with objects compiled by the COHERENT C compiler.  It also contains a
number of features not available with the 80286 dialect of aass, including macro
assembly.
#asfix
aassffiixx -- Convert assembly-language programs into as 80386 format

aassffiixx < _o_l_d_f_i_l_e > _n_e_w_f_i_l_e

#at
aatt -- Execute commands at given time

aatt [ -vv ] [ -cc _c_o_m_m_a_n_d ] _t_i_m_e [ [ _d_a_y ] _w_e_e_k ] [ _f_i_l_e ]
aatt [ -vv ] [ -cc _c_o_m_m_a_n_d ] _t_i_m_e _m_o_n_t_h _d_a_y [ _f_i_l_e ]

_O_p_t_i_o_n_s:
     -cc        Following argument gives command
     -vv        Print time for which command is set

If _f_i_l_e is given, read commands from it.  If neither _f_i_l_e nor -cc is given, read
commands from stdin.
#ATclock
AATTcclloocckk -- Read or set the AT realtime clock

/eettcc/AATTcclloocckk [_y_y[_m_m[_d_d[_h_h[_m_m[._s_s]]]]]]

With an argument, AATTcclloocckk sets your computer's realtime clock.  With no
argument, it reads it.
#atrun
aattrruunn -- Execute commands at a preset time


#awk
aawwkk -- Pattern-scanning language

aawwkk [-yy][-FF_c][-ff _p_r_o_g_f_i_l_e][_p_r_o_g][_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -FF_c       Set field separator character to _c (default, blank, and tab)
     -ff        _p_r_o_g_f_i_l_e is the aawwkk program; otherwise, first non-option
               argument is aawwkk program
     -yy        Dual case match (as in ggrreepp)

If no _f_i_l_e is present, the stdin is used.  File `-' means stdin.
#bad
bbaadd -- Maintain list of bad blocks

bbaadd _o_p_t_i_o_n _f_i_l_e_s_y_s_t_e_m [ block ... ]

_O_p_t_i_o_n_s:
     aa         Add blocks
     cc         Clear bad-block list
     dd         Delete blocks
     ll         List blocks
#badscan
bbaaddssccaann -- Build bad block list

/eettcc/bbaaddssccaann [ -vv ] [ -oo _p_r_o_t_o ] [ -bb _b_o_o_t ] _d_e_v_i_c_e _s_i_z_e
/eettcc/bbaaddssccaann [ -vv ] [ -oo _p_r_o_t_o ] [ -bb _b_o_o_t ] _d_e_v_i_c_e _x_d_e_v_i_c_e

_O_p_t_i_o_n_s:
     -bb _b_o_o_t   Insert bootstrap _b_o_o_t into _p_r_o_t_o
     -oo _p_r_o_t_o  Write prototype into file _p_r_o_t_o
     -vv        Print estimate of time remaining

Scan _d_e_v_i_c_e of _s_i_z_e bytes (or size given in hard disk partition table _x_d_e_v_i_c_e)
for bad blocks, write prototype to stdout.
#banner
bbaannnneerr -- Print large letters

bbaannnneerr [ _a_r_g_u_m_e_n_t ... ]

Print each _a_r_g_u_m_e_n_t as one line of large-text output.  If no arguments, print
each line from stdin as a line of large output.
#basename
bbaasseennaammee -- Strip path information from a file name

bbaasseennaammee _f_i_l_e [ _s_u_f_f_i_x ]

#bc
bbcc -- Interactive calculator with arbitrary precision

bbcc [ -ll ] [ _f_i_l_e ... ]

_O_p_t_i_o_n:
     -ll        Use the extended bbcc library

If no _f_i_l_e is specified, bbcc reads stdin.
#bind
bbiinndd -- Bind key sequence to editing command

bbiinndd [-mm] [_s_t_r_i_n_g [= _c_o_m_m_a_n_d]]

_O_p_t_i_o_n:
     -mm        Bind multiple commands to one keystroke

With no arguments, bbiinndd displays all current bindings.  kksshh only.
#boottime
bboooottttiimmee -- File that holds time system was last booted


#brc
bbrrcc -- Perform maintenance chores, single-user mode

/eettcc/bbrrcc

#break
bbrreeaakk -- Exit from shell construct

bbrreeaakk [ _n ]

Exit from _n (default, one) ffoorr, uunnttiill, or wwhhiillee constructs.  The shell executes
bbrreeaakk directly.
#build
bbuuiilldd -- Install COHERENT onto a hard disk

/eettcc/bbuuiilldd

#builtin
bbuuiillttiinn -- Execute a command as a built-in command

bbuuiillttiinn _c_o_m_m_a_n_d [ _a_r_g ... ]

kksshh only.
#c
cc -- Print multi-column output

cc [ -ll_N ] [ -ww_N ] [ -001122 ]

_O_p_t_i_o_n_s:
     -ll_N       Set the page length to _N lines
     -ww_N       Set the page width to _N columns
     -00        Order fields horizontally across the page
     -11        Order fields vertically down each column (default)
     -22        Special case of -1
#cal
ccaall -- Print a calendar

ccaall [ _m_o_n_t_h ] [ _y_e_a_r ]

#calendar
ccaalleennddaarr -- Reminder service

ccaalleennddaarr [ -aa ] [ -ff_f_i_l_e ]... [ -dd[_d_a_t_e] ] [ -ww[_d_a_t_e] ] [ -mm[_m_o_n_t_h] ]

_O_p_t_i_o_n_s:
     -aa        Search calendars of all users and send mail
     -ff_f_i_l_e    Search each _f_i_l_e in order given
     -dd[_d_a_t_e]  Print all entries matching _d_a_t_e
     -ww[_d_a_t_e]  Print entries in the week beginning with _d_a_t_e
     -mm[_m_o_n_t_h] Print entries in the given _m_o_n_t_h

The default calendar is $HHOOMMEE/.ccaalleennddaarr.  The default date is today.
#captoinfo
ccaappttooiinnffoo -- Convert termcap data to terminfo form

ccaappttooiinnffoo [_f_i_l_e_n_a_m_e]

#case
ccaassee -- Execute commands conditionally according to pattern

ccaassee _t_o_k_e_n iinn [_p_a_t_t_e_r_n [|_p_a_t_t_e_r_n] ...) _s_e_q_u_e_n_c_e ;;] ... eessaacc

The shell executes ccaassee directly.
#cat
ccaatt -- Concatenate/print files

ccaatt [ -uu ][ _f_i_l_e ... ]

_O_p_t_i_o_n:
     -uu        Do not buffer output in 512-byte blocks

File `-' indicates the standard input.  If no _f_i_l_e is specified, ccaatt reads
stdin.
#cc
cccc -- C compiler

cccc [_c_o_m_p_i_l_e_r _o_p_t_i_o_n_s] _f_i_l_e .... [_l_i_n_k_e_r _o_p_t_i_o_n_s]

_O_p_t_i_o_n_s:
     -BB[ssttrr]   Use backup compiler versions.
     -cc        Compile only -- no load
     -DD_n_a_m_e[=_v_a_l_u_e]
               Tell ccpppp to define _n_a_m_e with _v_a_l_u_e
     -EE        Run ccpppp only and send its output to stdout
     -ff        Include floating point output routines in load
     -IInnaammee    Tell ccpppp to look for header files in directory _n_a_m_e
     -KK        Keep intermediate files
     -LL_d_i_r_e_c_t_o_r_y
               Tell the linker lldd to search ddiirreeccttoorryy for its libraries before
               it searches the directories named in the environmental variable
               LLIIBBPPAATTHH
     -ll_n_a_m_e    Pass /lliibb/lliibb_n_a_m_e.aa to linker lldd
     -MM_s_t_r     Use alternative machine versions
     -NN[pp0011aabb22ssddllrrtt]_s_t_r
               Rename specified pass to _s_t_r
     -OO        Run peephole optimizer of C compiler
     -qq[pp0011aabb22ss]
               Quit after specified pass
     -QQ        Quiet: suppress all error messages, no matter how awful an error
               they indicate
     -SS        Place C compiler assembler output in a .ss file
     -TT_s_i_z_e    Tell cccc to use buffers of _s_i_z_e_n bytes each, instead of its
               default 64-kilobytes buffers (COHERENT 386 only)
     -tt[pp0011aabb22ssddllrrtt]
               Take specified compiler phases.
     -UU_n_a_m_e    Tell ccpppp to remove any initial definition of _n_a_m_e
     -VV        Run verbosely
     -VV_n_a_m_e    Toggle variant VV_n_a_m_e

Compiles files ending .cc; assembles files ending in .ss; passes other options
and files to the linker lldd.
#cd
ccdd -- Change directory

ccdd _d_i_r_e_c_t_o_r_y

If no _d_i_r_e_c_t_o_r_y specified, $HHOOMMEE is assumed.  The shell executes ccdd directly.
#cdmp
ccddmmpp -- Dump COFF files into a readable form

ccddmmpp [-aaddllrrss] _f_i_l_e_n_a_m_e

_O_p_t_i_o_n_s:
     -aa        Suppress auxiliary symbol entries
     -dd        Suppress data dumps
     -ll        Suppress line numbers
     -rr        Suppress relocation entries
     -ss        Suppress symbol entries
#cgrep
ccggrreepp -- Pattern search for C source programs

ccggrreepp [-ccllnnssAA] [-rr _n_e_w] _e_x_p_r_e_s_s_i_o_n _f_i_l_e ...

_O_p_t_i_o_n_s:
     -AA        Build _e_r_r_o_r _l_i_s_t for interactive editing using MicroEMACS, like
               -AA option to the cccc command.
     -cc        Print all C comments
     -ll        Return file where _e_x_p_r_e_s_s_i_o_n found
     -nn        Prefix each line containing _e_x_p_r_e_s_s_i_o_n_s with its number in its
               source file
     -rr        Replaces each _e_x_p_r_e_s_s_i_o_n with _n_e_w
     -ss        Print all C strings
#chase
cchhaassee -- Highly amusing video game

/uussrr/ggaammeess/cchhaassee [ -cc ] [ _s_p_e_e_d ]

_O_p_t_i_o_n_s:
     -cc        Color video card
     _s_p_e_e_d     Speed of game: the lower the number, the faster the speed
               (default, 10)
#check
cchheecckk -- Check file system

cchheecckk [-ss] _f_i_l_e_s_y_s_t_e_m ...

_O_p_t_i_o_n:
     -ss        Salvage as much as possible, given the problems detected
#checklist
cchheecckklliisstt -- File systems to check when booting COHERENT

/eettcc/cchheecckklliisstt

#chgrp
cchhggrrpp -- Change the group owner of a file

cchhggrrpp _g_r_o_u_p _f_i_l_e ...

#chmod
cchhmmoodd -- Change the modes of a file

cchhmmoodd +_m_o_d_e_s _f_i_l_e
cchhmmoodd -_m_o_d_e_s _f_i_l_e


Mode may be octal or a comma-separated symbolic list: [_w_h_i_c_h]_h_o_w_p_e_r_m...[,...]
_w_h_i_c_h:
     aa         User, group, and other permissions
     gg         Group permissions
     oo         Other permissions
     uu         User permissions

Missing _w_h_i_c_h implies that `a', `g', `o', and `u' can be combined.
_h_o_w:
     =         Set permissions
     +         Add permissions
     -         Take away permissions
_p_e_r_m:
     gg         Current group permissions
     oo         Current other permissions
     rr         Read
     ss         Setuid on execution
     tt         Sticky bit (save text)
     uu         Current user permissions
     ww         Write
     xx         Execute
#chmog
cchhmmoogg -- Change mode, owner, and group simultaneously

cchhmmoogg _m_o_d _o_w_n _g_r_p _f_i_l_e ...

#chown
cchhoowwnn -- Change the owner of files

cchhoowwnn _o_w_n_e_r _f_i_l_e ...

#chroot
cchhrroooott -- Change root directory

cchhrroooott _d_i_r_e_c_t_o_r_y _p_r_o_g_r_a_m ...

#ckermit
cckkeerrmmiitt -- Interactive inter-system communication and file transfer

cckkeerrmmiitt [-aabbccddeeffgghhiikkllppqqrrssttwwxx] [ _f_i_l_e ... ]

_O_p_t_i_o_n_s
     -aa _f_i_l_e_n_a_m_e
               Give an alternate name to file
     -bb _b_a_u_d_r_a_t_e
               Set the baud rate of the device to _b_a_u_d_r_a_t_e
     -cc        Connect
     -dd        Use debug mode
     -ee _n      Set the length of the packet to _n
     -ff        Send a ``finish'' command to a remote server
     -gg _f_i_l_e   Ask a remote system to send _f_i_l_e
     -hh        Print help
     -ii        Specify that the file being transferred is binary
     -kk        Passively receive files
     -ll _d_e_v_i_c_e Name the serial device to be used
     -nn        Like -cc, but used after a protocol transaction has occurred
     -pp _x      Set parity to _x
     -qq        Quiet mode -- no messages
     -rr        Receive files
     -ss _f_i_l_e   Send _f_i_l_e
     -tt        Specify half duplex
     -ww        Write-protect -- avoid file-name collisions for incoming files
     -xx        Begin server operation
#clear
cclleeaarr -- Clear the screen

cclleeaarr

#clri
ccllrrii -- Clear i-node

/eettcc/ccllrrii _f_i_l_e_s_y_s_t_e_m _i_n_u_m_b_e_r ...

#cmp
ccmmpp -- Compare bytes of two files

ccmmpp [-llss] _f_i_l_e_1 _f_i_l_e_2 [_s_k_i_p_1 _s_k_i_p_2]

_O_p_t_i_o_n_s:
     -ll        Print byte number and bytes at each difference
     -ss        Return status (print nothing)

If _f_i_l_e_1 is `-', use stdin.  If _s_k_i_p_1 and _s_k_i_p_2 are present, they are the
number of bytes to skip before comparing _f_i_l_e_1 and _f_i_l_e_2, respectively.
#col
ccooll -- Remove reverse and half-line motions

ccooll [ -bbddffxx ][ -pp_n ]

_O_p_t_i_o_n_s:
     -bb        Output device cannot backspace
     -dd        Double spaced output
     -ff        The output device can handle half lines (has precedence over -dd)
     -pp_n       Set page buffer to _n lines (default, 128)
     -xx        Suppress conversion of white space to tabs on output
#comm
ccoommmm -- Print common lines

ccoommmm [ -112233 ] _f_i_l_e_1 _f_i_l_e_2

_O_p_t_i_o_n_s:
     -11        Suppress column 1
     -22        Suppress column 2
     -33        Suppress column 3

Column 1 has lines unique to _f_i_l_e_1; column 2 has lines unique to _f_i_l_e_2; column
3 has lines common to both files.  Both files should be sorted.
#compress
ccoommpprreessss -- Compress a file

ccoommpprreessss [ -ddffvvcc ] [ -bb_n_u_m ] [ -ww _t_m_p_f_i_l_e ] [ _f_i_l_e ... ] (COHERENT 286)
ccoommpprreessss [ -ddffvvcc ] [ -bb_n_u_m ] [ _f_i_l_e ... ] (COHERENT 386)

_O_p_t_i_o_n_s:
     -bb_n_u_m     Set compression to _n_u_m
     -cc        Send output to ssttddoouutt
     -dd        Decompress, rather than compress
     -ff        Force output file, even if no space saved by compression
     -vv        Verbose mode
     -ww _t_m_p_f_i_l_e
               Use _t_m_p_f_i_l_e as the workfile (default, /ddeevv/rraamm11).  COHERENT 286
               only.
#continue
ccoonnttiinnuuee -- Terminate current iteration of shell construct

ccoonnttiinnuuee [ _n ]

Terminate current iteration of _n (default, one) ffoorr, uunnttiill, or wwhhiillee
constructs.  The shell executes ccoonnttiinnuuee directly.
#conv
ccoonnvv -- Numeric base converter

ccoonnvv [_n_u_m_b_e_r]

If no _n_u_m_b_e_r is given, reads one number per line from stdin.
#cp
ccpp -- Copy a file

ccpp [ -dd ]  _o_l_d_n_a_m_e _n_e_w_n_a_m_e
ccpp [ -dd ]  _f_i_l_e_1 ... _f_i_l_e_N _d_i_r_e_c_t_o_r_y

_O_p_t_i_o_n:
     -dd        Preserve date (_m_t_i_m_e) on destination files.
#cpdir
ccppddiirr -- Copy directory hierarchy

ccppddiirr [_o_p_t_i_o_n ... ] _d_i_r_1 _d_i_r_2

_O_p_t_i_o_n_s:
     -aa        Verbose file by file account on one line
     -dd        Preserve last-modified date
     -ee        Recover from errors and continue
     -rr[_n]     _R_e_c_u_r _n levels only (default, one)
     -ss_n_a_m_e    Suppress copy of _n_a_m_e, which is relative to _d_i_r_1
     -tt        Test and report errors -- do not change anything
     -uu        Update regular files if more recent
     -vv        Verbose file by file account
#cpio
ccppiioo -- Archiving/backup utility

ccppiioo -oo[BBaaccvv]
ccppiioo -ii[BBccddffmmrrttuuvv] [_p_a_t_t_e_r_n...]
ccppiioo -pp[aaddllmmrruuvv] _d_i_r_e_c_t_o_r_y

_O_p_t_i_o_n_s:
     -aa        Reset access time of input files after copying
     -BB        Change size of a block
     -cc        Write header information in ASCII rather than binary
     -dd        Create directories as needed
     -ff_p_a_t_t_e_r_n Copy all files except those matching _p_a_t_t_e_r_n
     -ii        Read the standard input
     -ll        Link files rather than copying them
     -mm        Retain previous modification times
     -oo_p_a_t_t_e_r_n Copy all files matching _p_a_t_t_e_r_n
     -pp        Read stdin for files names to copy to destination
     -rr        Interactively rename files
     -tt        Print table of contents of an existing archive
     -uu        Copy files unconditionally
     -vv        Verbose output
#cpp
ccpppp -- C preprocessor

/lliibb/ccpppp [_o_p_t_i_o_n...] [_f_i_l_e...]

_O_p_t_i_o_n_s:
     -DD_V_A_R_I_A_B_L_E
               Define _V_A_R_I_A_B_L_E
     -II _d_i_r    Search _d_i_r for header files
     -oo _f_i_l_e   Write output into _f_i_l_e
     -UU_V_A_R_I_A_B_L_E
               Undefine _V_A_R_I_A_B_L_E
#cron
ccrroonn -- Execute commands periodically

/eettcc/ccrroonn&

cron -- execute commands periodically Usage:  /etc/cron& Options:  None cron is
invoked only once, usually from /eettcc/rrcc.  Thereafter, it sleeps in the
background, awaking periodically to check crontab files -- either the file
/uussrr/lliibb/ccrroonnttaabb if it exists, or the files in directory
/uussrr/ssppooooll/ccrroonn/ccrroonnttaabbss if /uussrr/lliibb/ccrroonnttaabb does not exist.

Entries in a crontab file consist of commands preceded by five fields; these
represent minute (0-59), hour (0-23), day of the month (1-31), month (1-12),
and day of the week (1-7).  An asterisk `*' in a field means all possible
entries for that field.
#crontab
ccrroonnttaabb -- Copy a command file into the crontab directory

/uussrr/bbiinn/ccrroonnttaabb [-ll] [-rr] [-ff _f_i_l_e_n_a_m_e] [-mm[eedd]] [-uu_u_s_e_r]

_O_p_t_i_o_n:
     -ff _f_i_l_e_n_a_m_e
               Replace a user's command file.
     -ll        List your command file.
     -mm[eedd]    Enable/disable sending mail upon failure of a command within a
               command file.
     -rr        Remove user's command file.
     -uu_u_s_e_r    Specify that the file being copied is to be applied to _u_s_e_r.
               Only the superuser rroooott can execute this option.
#crypt
ccrryypptt -- Encrypt/decrypt text

ccrryypptt [_p_a_s_s_w_o_r_d]

Password is ten characters or fewer.  The same password encrypts and decrypts.
#ctags
ccttaaggss -- Generate tags and refs files for vi editor

ccttaaggss [-rr] _f_i_l_e_s...

#cut
ccuutt -- Select portions of each line of its input

ccuutt -cc_l_i_s_t [_f_i_l_e ...]
ccuutt -ff_l_i_s_t [-ss] [-dd _c_h_a_r] [_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -cc _l_i_s_t   _l_i_s_t specifies character positions
     -dd _c_h_a_r   Use _c_h_a_r as field delimiter
     -ff _l_i_s_t   _l_i_s_t specifies fields
     -ss        Suppress lines without field delimiters
#date
ddaattee -- Print/set the date and time

ddaattee [-ss] [-uu] [[_y_y_m_m_d_d]_h_h_m_m[._s_s]]

_O_p_t_i_o_n_s:
     -ss        Suppress daylight savings time conversion
     -uu        Print (and enter) date in Greenwich Mean Time
#db
ddbb -- Assembler-level symbolic debugger

ddbb [-ccddeeffoorrtt] [_m_a_p_f_i_l_e] [_p_r_o_g_r_a_m]

_O_p_t_i_o_n_s:
     -cc        Map _p_r_o_g_r_a_m as a core file
     -dd        Map _p_r_o_g_r_a_m as a system dump; _m_a_p_f_i_l_e defaults to /ccoohheerreenntt
     -ee        Next argument is object file and rest of command line is passed
               to the child process
     -ff        Map _p_r_o_g_r_a_m as binary data
     -oo        _p_r_o_g_r_a_m is an object file
     -rr        Access all files read-only
     -tt        Perform input and output via /ddeevv/ttttyy rather than stdin and
               stdout

By default, _p_r_o_g_r_a_m is assumed to be an object file.  _m_a_p_f_i_l_e defaults to ll.oouutt
and _p_r_o_g_r_a_m defaults to ccoorree.
#dc
ddcc -- Desk calculator

ddcc [_f_i_l_e]

Arbitrary precision desk calculator with registers, using reverse-Polish
notation.  Reads input from _f_i_l_e if given, then from stdin.
#dcheck
ddcchheecckk -- Check directory consistency

ddcchheecckk [-ss] [-ii _i_n_u_m_b_e_r...] _f_i_l_e_s_y_s_t_e_m ...

_O_p_t_i_o_n_s:
     -ss        Cause ddcchheecckk to correct link counts automatically
     -ii        Print information about each given i-number
#dd
dddd -- File conversion

dddd [_o_p_t_i_o_n=_v_a_l_u_e] ...

_O_p_t_i_o_n_s:
     bbss=_n      Set I/O buffer size to _n
     ccbbss=_n     Set conversion buffer size to _n
     ccoonnvv=_l_i_s_t Comma-separated list of conversions:
        aasscciiii  Convert EBCDIC to ASCII
        eebbccddiicc Convert ASCII to standard EBCDIC
        iibbmm    Convert ASCII to IBM print codes
        llccaassee  Map all letters to lower case
        nnooeerrrroorr
               Continue if error occurs
        sswwaabb   Swap byte pairs
        ssyynncc   Pad input to _i_b_s
        uuccaassee  Map all letters to upper case
     ccoouunntt=_n   Number of buffers to copy from input
     ffiilleess=_n   Number of files to copy (useful with tape)
     iibbss=_n     Input buffer size
     iiff=_f_i_l_e   Set input file to _f_i_l_e
     oobbss=_n     Set output block size to _n
     ooff=_f_i_l_e   Set output file to _f_i_l_e
     sseeeekk=_n    Set seek position of output to _n
     sskkiipp=_n    Skip _n input blocks
#deroff
ddeerrooffff -- Remove text formatting control information

ddeerrooffff [-ww] [-xx] [_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -ww        Divide the output into words, one per line
     -xx        Extra knowledge of macro packages
#detab
ddeettaabb -- Replace tab characters with spaces

ddeettaabb [-tt_t_a_b_s_i_z_e]

_O_p_t_i_o_n:
     -tt_t_a_b_s_i_z_e Set _t_a_b_s_i_z_e (2-256, inclusive)
#df
ddff -- Measure free space on disk

ddff [-aaiitt] _d_e_v_i_c_e

_O_p_t_i_o_n_s:
     -aa        Give entries only for mounted devices
     -ii        Summarize i-node usage
     -tt        Give total number of blocks on _d_e_v_i_c_e
#diff
ddiiffff -- Summarize differences between two files

ddiiffff [-bbddeeffhh] [-cc _s_y_m_b_o_l] _f_i_l_e_1 _f_i_l_e_2

_O_p_t_i_o_n_s:
     -bb        Ignore trailing blanks; all strings of blanks are equal
     -cc _s_y_m    Make ccpppp input conditionalized on _s_y_m
     -dd        Use -hh algorithm for large (>25,000 character) files
     -ee        Make eedd script
     -ff        Make fake (non-usable) eedd script
     -hh        Half-hearted algorithm (works on long files)
     -ss        Make sseedd script

If either _f_i_l_e_1 or _f_i_l_e_2 is `-', stdin is used.  If one _f_i_l_e is a directory,
the other _f_i_l_e under that directory is used.
#diff3
ddiiffff33 -- Summarize differences among three files

ddiiffff33 [-eexx33] _f_i_l_e_1 _f_i_l_e_2 _f_i_l_e_3

_O_p_t_i_o_n_s:
     -ee        Make eedd script to change _f_i_l_e_2 and _f_i_l_e to _f_i_l_e_1 (changes marked
               with ==== or ====33)
     -xx        Above script with changes marked ==== (all different)
     -33        Above script with changes marked ====33 (_f_i_l_e_3 different)
#dirs
ddiirrss -- Print the contents of the directory stack

ddiirrss

sshh only.
#disable
ddiissaabbllee -- Disable a port

/eettcc/ddiissaabbllee _p_o_r_t...

#domain
ddoommaaiinn -- Set your system's mail domain

/eettcc/ddoommaaiinn

#dos
ddooss -- Manipulate files on MS-DOS file systems

ddooss [-]ddFFllrrttxx[_f_l_a_g_s] [_d_e_v_i_c_e] [_f_i_l_e ...]

_C_o_m_m_a_n_d_s:
     dd         Delete specified files
     FF         Build MS-DOS file system (format)
     ll[_l_a_b_e_l]  Label disk
     rr         Replace _f_i_l_e_s (default, all files in `.')
     tt         List contents (default, all files)
     xx         Extract specified _f_i_l_e_s (default, all files)
_F_l_a_g_s:
     aa         ASCII data extract/replace (default, binary data)
     cc         Read only; do not write changes to MS-DOS file system
     kk         Keep _m_t_i_m_e on extract/replace (default, now)
     nn         Newest files first in list (default, alphabetized)
     pp         Piped extract/replace
     ss_d_i_r      Suppress subdirectory _d_i_r
     vv         Verbose
     [11-99]     Specify logical drive on extended MS-DOS partition

The default device is /ddeevv/ddooss.
#doscat
ddoossccaatt -- Concatenate a file on an MS-DOS file system

ddoossccaatt _d_e_v_i_c_e:[/_d_i_r_e_c_t_o_r_y/]_f_i_l_e

#doscp
ddoossccpp -- Copy files to/from an MS-DOS file system

ddoossccpp [-aabbkkmmrrvv] _s_r_c _d_e_s_t

_O_p_t_i_o_n_s
     aa         ASCII.  When copying from MS-DOS to COHERENT, convert the
               carriage-return/newline combination to newline characters; when
               copying from COHERENT to MS-DOS, do the opposite.
     bb         Binary.  Do not convert newline conversion.
     kk         Keep the time stamp on copied files.
     mm         Move.  Same as aa, described above.
     rr         Same as bb, described above.
     vv         Verbose.  Describe each action as it is executed.
#doscpdir
ddoossccppddiirr -- Copy a directory to/from an MS-DOS file system

ddoossccppddiirr [-aakkmmvv] _s_r_c _d_e_s_t

_O_p_t_i_o_n_s
     aa         ASCII.  When copying from MS-DOS to COHERENT, convert the
               carriage-return/newline combination to newline characters; when
               copying from COHERENT to MS-DOS, do the opposite.
     kk         Keep the time stamp on copied files.
     mm         Move.  Same as aa, described above.
     vv         Verbose.  Describe each action as it is executed.
#dosdel
ddoossddeell -- Delete a file from an MS-DOS file system

ddoossddeell [-vv] _d_e_v_i_c_e:/_d_i_r/_f_i_l_e

_O_p_t_i_o_n
     vv         Verbose.  Describe each action as it is executed.
#dosdir
ddoossddiirr -- List contents of an MS-DOS directory

ddoossddiirr [-nnvv] _d_e_v_i_c_e:[_d_i_r/][_f_i_l_e]

_O_p_t_i_o_n_s
     nn         List files in order of creation (newest file last) rather than
               in alphabetical order.
     vv         Verbose.  Describe each action as it is executed.
#dosformat
ddoossffoorrmmaatt -- Format a floppy disk

ddoossffoorrmmaatt [-vv] _d_e_v_i_c_e

_O_p_t_i_o_n
     vv         Verbose.  Describe each action as it is executed.
#doslabel
ddoossllaabbeell -- Label an MS-DOS floppy disk

ddoossllaabbeell [-vv] _d_e_v_i_c_e: _l_a_b_e_l

_O_p_t_i_o_n
     vv         Verbose.  Describe each action as it is executed.
#dosls
ddoossllss -- List files on an MS-DOS file system

ddoossllss [-vv] _d_e_v_i_c_e:[/_d_i_r_e_c_t_o_r_y/][_f_i_l_e]

_O_p_t_i_o_n:
     -vv        Print output in long format, analogous to llss -ll.
#dosmkdir
ddoossmmkkddiirr -- Create a directory in an MS-DOS file system

ddoossmmkkddiirr _d_e_v_i_c_e:_d_i_r_e_c_t_o_r_y

#dosrm
ddoossrrmm -- Remove a file from an MS-DOS file system

ddoossrrmm _d_e_v_i_c_e:[/_d_i_r_e_c_t_o_r_y/]_f_i_l_e

#dosrmdir
ddoossrrmmddiirr -- Remove a directory from an MS-DOS file system

ddoossrrmmddiirr _d_e_v_i_c_e:_d_i_r_e_c_t_o_r_y

#drvld
ddrrvvlldd -- Load a loadable driver into memory

/eettcc/ddrrvvlldd _o_p_t_i_o_n_s _d_r_i_v_e_r

_O_p_t_i_o_n_s:
     -kk _k_e_r_n_e_l Use the symbol table from _k_e_r_n_e_l instead of the default
               /ccoohheerreenntt.
     -rr        Remove any temporary files it creates in directory /ttmmpp.
     -oo _o_u_t_f_i_l_e
               Write debugginf symbol table to _o_u_t_f_i_l_e rather than to
               /ttmmpp/_d_r_i_v_e_r.
#drvld.all
ddrrvvlldd.aallll -- Load loadable drivers at boot time

/eettcc/ddrrvvlldd.aallll

#du
dduu -- Summarize disk usage

dduu [-aa] [-ss] [_d_i_r_e_c_t_o_r_y ...]

_O_p_t_i_o_n_s:
     -aa        Print an entry for each file
     -ss        Print only a summary
#dump
dduummpp -- File-system backup utility

dduummpp [_o_p_t_i_o_n_s] [_a_r_g_u_m_e_n_t ...]

_O_p_t_i_o_n_s:
     00-99       Set dump level (default, 9)
     bb         Next argument is blocking factor (default, 20)
     dd         Next argument is density in bpi (default, 1600)
     ff         Next argument is output device name
     ss         Next argument is tape length in feet (default, 2300)
     SS         Next argument is floppy disk size in blocks
     uu         Update /eettcc/ddddaattee
     vv         Verbose (display date and tape length)
#dumpdate
dduummppddaattee -- Print dump dates

dduummppddaattee [_f_i_l_e_s_y_s_t_e_m ...]

#dumpdir
dduummppddiirr -- Print the directory of a dump

dduummppddiirr [aaff [_a_r_g_u_m_e_n_t ...] ]

_O_p_t_i_o_n_s:
     aa         List normally suppressed `.' and `..' names
     ff         Next argument is dump device name (default, /ddeevv/dduummpp)
#echo
eecchhoo -- Repeat/expand an argument

eecchhoo [-nn] [_a_r_g_u_m_e_n_t ...]

_O_p_t_i_o_n:
     -nn        Do not print terminal newline

Copies all command arguments to the standard output, with the following
special-character sequences being replaced with the equivalent ASCII character:
     \bb        Backspace
     \cc        Print line without a newline (like -nn option)
     \ff        Formfeed
     \nn        Newline
     \rr        Carriage return
     \tt        Tab
     \vv        Vertical tab
     \\        Backslash
     \_n_n_n      _n_n_n is octal value of desired character
#ed
eedd -- Interactive line editor

eedd [-] [+ccmmooppssvv] [_f_i_l_e]

_O_p_t_i_o_n_s:
     -         Suppress character counts on rr, ww, ee commands
     -xx        Encrypt _f_i_l_e
     +cc        Print character counts on rr, ww, ee
     +mm        Allow multiple commands per line
     +oo        Print line counts instead of character counts
     +pp        Prompt for each command with `*'
     +ss        Lower case matches upper in patterns
     +vv        Verbose error messages
#egrep
eeggrreepp -- Extended pattern search

eeggrreepp [_o_p_t_i_o_n ...] [_p_a_t_t_e_r_n] [_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -AA        Build _e_r_r_o_r _l_i_s_t for interactive editing using MicroEMACS, like
               -AA option to the cccc command
     -bb        Each output line has block number of match
     -cc        Print only a count of the matching lines
     -ee        Next argument is _p_a_t_t_e_r_n
     -ff        Next argument is file with one pattern per line
     -hh        Suppress printing of file names on matched lines
     -ll        Print only names of files containing matches
     -nn        Print line number of file with each matched line output
     -ss        Suppress output, just return status
     -vv        Negate the sense of match
     -yy        Lower-case letters in _p_a_t_t_e_r_n match upper- and lower-case

The _p_a_t_t_e_r_n is a pattern roughly like that found in eedd.  If no _f_i_l_e is
specified, stdin is read.  eeggrreepp is like ggrreepp -aa, but is an order of magnitude
faster.
#elvis
eellvviiss -- Clone of Berkeley-standard screen editor

eellvviiss [ _o_p_t_i_o_n_s ] [ +_c_m_d ] [ _f_i_l_e_1 ... _f_i_l_e_2_7 ]

_O_p_t_i_o_n_s:
     -ee        Begin in colon-command mode
     -ii        Begin in input mode
     -rr        Recover a previous edit
     -RR        Read-only mode
     -tt _t_a_g    Begin editing at _t_a_g
     -mm        Use in error-handling mode
     -vv        Begin in visual-command mode
     +_c_o_m_m_a_n_d  Execute _c_o_m_m_a_n_d before editing
#enable
eennaabbllee -- Enable a port

/eettcc/eennaabbllee _p_o_r_t...

#env
eennvv -- Execute a command in an environment

eennvv [-] [_V_A_R_I_A_B_L_E=_v_a_l_u_e ...] [_c_o_m_m_a_n_d _a_r_g_s]

#epson
eeppssoonn -- Print files on Epson printer

eeppssoonn [ -ccddffrrww88 ] [ -bb _h_e_a_d ] [ -ii _n ] [ -oo _o_f_i_l_e ] [ -ss _n ] [ _f_i_l_e ... ]

_O_p_t_i_o_n_s:
     bb _h_e_a_d    Print wide banner _h_e_a_d at top of first page
     cc         Compressed printing
     dd         Print boldface with double strike, not emphasize mode
     ff         Suppress formfeed after each _f_i_l_e
     ii_n        Indent output 'n' spaces
     oo _o_f_i_l_e   Send output to _o_f_i_l_e (default, /ddeevv/llpp)
     rr         Use only Roman character set (no italics)
     ss_n        Vertical spacing _n (default, 1)
     ww         Double-width printing
     88         Eight lines per inch (default, six)
#eval
eevvaall -- Evaluate arguments

eevvaall [_t_o_k_e_n ...]

The shell executes eevvaall directly.
#ex
eexx -- Berkeley-style line editor

eexx [ _o_p_t_i_o_n_s ] [ +_c_m_d ] [ _f_i_l_e_1 ... _f_i_l_e_2_7 ]

_O_p_t_i_o_n_s:
     -rr        Recover a previous edit
     -RR        Read-only mode
     -tt _t_a_g    Begin editing at _t_a_g
     -mm        Use in error-handling mode
     +_c_o_m_m_a_n_d  Execute _c_o_m_m_a_n_d before editing
#exec
eexxeecc -- Execute command directly

eexxeecc [_c_o_m_m_a_n_d]

The shell executes _c_o_m_m_a_n_d by eexxeecc rather than ffoorrkk.  This normally terminates
the current shell.  Current shell I/O may be redirected by eexxeecc with no
_c_o_m_m_a_n_d.
#exit
eexxiitt -- Exit from a shell

eexxiitt [_s_t_a_t_u_s]

The previous status is retained if none is specified.  eexxiitt sets the status but
does not terminate an interactive shell.  The shell executes eexxiitt directly.
#export
eexxppoorrtt -- Add a shell variable to the environment

eexxppoorrtt [_n_a_m_e ...]
eexxppoorrtt [_n_a_m_e=_v_a_l_u_e]

#expr
eexxpprr -- Compute a command-line expression

eexxpprr _a_r_g_u_m_e_n_t ...

_O_p_t_i_o_n_s:
     nn         Any integer with optional sign
     _s_t_r_i_n_g    Used with comparisons and lleenn operator
     +         Arithmetic operators (one of `+', `-', `*', `/', `%')
     !         Unary not
     -         Unary minus
     ==        Relational operators (one of `>', `<', `>=', `<=', `==', `!=')
     &         Logical AND of previous and next expression
     |         Logical OR of previous and next expression
     lleenn       Length of string given by next argument
     _e_1:_e_2     Set to number of characters matching regular expression _e_2 in
               string _e_1; if _e_2 contains any `\(...\)' sequences, result is
               concatenation of matched parts
     ( _e )     Parentheses for grouping
     {
               EEvvaalluuaattee _e_2 if _e_1 is true, _e_3 otherwise; _e_3 defaults to 0 if
               missing
#factor
ffaaccttoorr -- Factor a number

ffaaccttoorr [ _n_u_m_b_e_r ... ]

#false
ffaallssee -- Unconditional failure

ffaallssee

#fc
ffcc -- Edit and re-execute one or more previous commands

ffcc [-llnn] [_f_i_r_s_t [_l_a_s_t]]
ffcc -ss [_o_l_d=_n_e_w] [_c_o_m_m_a_n_d]"

_O_p_t_i_o_n_s:
     -ll        Print commands on stdout
     -nn        Suppress default command numbers

kksshh only.
#fdformat
ffddffoorrmmaatt -- Low-level format a floppy disk

/eettcc/ffddffoorrmmaatt [ _o_p_t_i_o_n ... ] _s_p_e_c_i_a_l

_O_p_t_i_o_n_s:
     -aa        Print information on stdout during format
     -ii _n      Interleave factor _n (0-7; default, 6)
     -oo _n      Skew factor _n for sector numbering (default, 0)
     -vv        Verify
     -ww _f_i_l_e   Copy _f_i_l_e to formatted floppy disk track by track
#fdisk
ffddiisskk -- Hard-disk partitioning utility

/eettcc/ffddiisskk [-rr] [-cc] [-bb _m_b_o_o_t] _x_d_e_v ...

_O_p_t_i_o_n_s:
     -rr        Read-only access
     -bb        Add master boot code from file _m_b_o_o_t
     -cc        Specify disk geometry for non-standard drives

A hard disk can be split into a maximum of four partitions (logical devices).
#file
ffiillee -- Guess a file's type

ffiillee _f_i_l_e ...

#find
ffiinndd -- Search for files satisfying a pattern

ffiinndd _d_i_r_e_c_t_o_r_y ... [_e_x_p_r_e_s_s_i_o_n ...]

_E_x_p_r_e_s_s_i_o_n:
     -aattiimmee _n  File has been accessed in _n days
     -ccttiimmee _n  File's i-node has been changed in _n days
     -eexxeecc _c_m_d Command _c_m_d is successful
     -ggrroouupp _g_n File belongs to group _g_n
     -iinnuumm _n   File has i-node _n
     -lliinnkkss _n  File has _n links to it
     -mmttiimmee _n  File has been modified within _n days
     -nnaammee _p_a_t_t_e_r_n
               File name matches _p_a_t_t_e_r_n (shell conventions)
     -nneewweerr_f_i_l_e
               File has been modified since _f_i_l_e
     -nnoopp      Always true; does nothing
     -ookk _c_m_d   Like -eexxeecc, except it asks
     -ppeerrmm _o_c_t_a_l
               File permissions are _o_c_t_a_l
     -pprriinntt    Always true; prints current path name
     -ssiizzee _n   File is _n blocks long
     -ttyyppee _c   File matches type (_c may be [bcdfmp])
     -uusseerr _u_n_a_m_e
               _u_n_a_m_e owns file
     eexxpp -aa _e_x_p _e_x_p
               Both expressions are true
     eexxpp -oo _e_x_p _e_x_p
               One of the expressions is true
     ! _e_x_p     Expression is false
     (_e_x_p)     Parentheses for grouping

If no expression is specified, -pprriinntt is assumed.
#fixstack
ffiixxssttaacckk -- Change stack allocation

ffiixxssttaacckk +-_v_a_l_u_e [ _f_i_l_e_n_a_m_e ]

This command applies to COHERENT 286 only
#fnkey
ffnnkkeeyy -- Set/print function keys for the console

ffnnkkeeyy [ _n [ _s_t_r_i_n_g ] ]

Sets function key _n to send _s_t_r_i_n_g; if no _s_t_r_i_n_g, set it to send nothing.  If
no arguments, ffnnkkeeyy prints the function keys.
#for
ffoorr -- Execute commands for tokens in list

ffoorr _n_a_m_e [iinn _t_o_k_e_n ...] ddoo _s_e_q_u_e_n_c_e ddoonnee

If _i_n clause is omitted, list of positional parameters to current script is
assumed.  Both ddoo and ddoonnee must be first token on line or preceded by `;'.  The
shell executes ffoorr directly.
#fortune
ffoorrttuunnee -- Print randomly selected, hopefully humorous, text

/uussrr/ggaammeess/ffoorrttuunnee [ _f_i_l_e ]

_O_p_t_i_o_n:
     _f_i_l_e      Read a fortune from _f_i_l_e, instead of the default file
               /uussrr/ggaammeess/lliibb/ffoorrttuunneess
#from
ffrroomm -- Generate list of numbers, for use in loop

ffrroomm _s_t_a_r_t ttoo _s_t_o_p [ bbyy _i_n_c_r ]

_s_t_a_r_t, _s_t_o_p, and _i_n_c_r (default, one) are decimal integers with optional `-'.
#fsck
ffsscckk -- Check and repair file systems interactively

/eettcc/ffsscckk [ -ffnnqqssSSyy ] [ -tt _t_e_m_p_f_i_l_e ] [ _f_i_l_e_s_y_s_t_e_m ... ]

_O_p_t_i_o_n_s:
     -ff        Fast check; check only if a block is claimed by more than one i-
               node, by an i-node and the free list, or more than once in the
               free list
     -nn        Default reply of no to all queries
     -qq        Quiet option; syppress file name warning messages
     -ss        Force reconstruction of the free list for all unmounted file
               systems.
     -SS        Same as -ss, but works on mounted file systems as well.  Not for
               the faint of heart.
     -tt        Use _t_e_m_p_f_i_l_e instead of /ddeevv/rrrraamm11 for temporary storage
     -yy        Default reply of yes to all queries
#fwtable
ffwwttaabbllee -- Build font-width table

ffwwttaabbllee [ -ppvv ] [ _i_n_f_i_l_e [ _o_u_t_f_i_l_e ] ]

_O_p_t_i_o_n_s:
     -pp        Input is PostScript AFM file, not PCL bitmap font
     -vv        Write a brief font description to stderr
#getopts
ggeettooppttss -- Parse command-line options

ggeettooppttss _o_p_t_s_t_r_i_n_g _n_a_m_e [ _o_p_t ]

kksshh only.
#getty
ggeettttyy -- Terminal initialization

/eettcc/ggeettttyy _t_y_p_e

#grep
ggrreepp -- Pattern search

ggrreepp [ooppttiioonn ...] [_p_a_t_t_e_r_n] [_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -aa        Extra metacharacters supported (`(...)', `|', `+', and `?')
     -bb        Each output line has block number of match
     -cc        Print only count of matching lines
     -ee        Next argument is pattern
     -ff        Next argument is file containing one pattern per line
     -hh        Suppress printing of file names on matched lines
     -ll        Print only names of files containing matches
     -nn        Print line number of file with each matched line output
     -ss        Suppress output, just return status
     -vv        Negate sense of match
     -xx        Exact match (don't expand metacharacters)
     -yy        Lower-case letters in _p_a_t_t_e_r_n match upper- and lower-case

The _p_a_t_t_e_r_n is a regular expression roughly like that found in eedd.  If no _f_i_l_e
is specified, stdin is read.
#guess
gguueessss -- Extraordinarily amusing guessing game

/uussrr/ggaammeess/gguueessss

#hash
hhaasshh -- Add a command to the shell's hash table

hhaasshh [-rr] [_c_o_m_m_a_n_d ... ]

_O_p_t_i_o_n:
     -rr        Remove _c_o_m_m_a_n_d from hash table

kksshh only.
#head
hheeaadd -- Print the beginning of a file

hheeaadd [+_n[bbccll]] [_f_i_l_e]
hheeaadd [-_n[bbccll]] [_f_i_l_e]

_O_p_t_i_o_n_s:
     +         Count from beginning of file
     -         Count from end of file
     bb         Count in blocks
     cc         Count in characters
     ll         Count in lines
#help
hheellpp -- Print concise description of command

hheellpp [-dd_c] [-ff_f_i_l_e] [-ii_f_i_l_e] [-rr] [_c_o_m_m_a_n_d]...

_O_p_t_i_o_n_s
     -dd_c       Use character _c as the delimiter between helpfile entries.
     -ff_f_i_l_e    Read _f_i_l_e as the helpfile, instead of the default /eettcc/hheellppffiillee.
     -ii_f_i_l_e    Read _f_i_l_e as the helpfile's index, instead of the default
               /eettcc/hheellppiinnddeexx.
     -rr        Rebuild the helpfile's index.

If _c_o_m_m_a_n_d is omitted, print information about $LLAASSTTEERRRROORR.
#hp
hhpp -- Prepare files for Hewlett-Packard LaserJet printer

hhpp [ -aaccffllrr ] [ -ii_m_a_r_g ] [ -tt_t_o_p ] [ -pp_l_i_n_e_s ] [ _f_i_l_e ... ]

_O_p_t_i_o_n_s:
     -aa        Substitute ` ' for '
     -cc        Toggle cartridge in place switch
     -ff        Print pages in forward order (default)
     -ll        Landscape mode
     -ii_m_a_r_g    Indent to _m_a_r_g
     -pp_l_i_n_e_s   Page length is _l_i_n_e_s
     -rr        Print pages in reverse order (for LaserJet I).
     -tt_m_a_r_g    Set top margin to _m_a_r_g
#hpd
hhppdd -- Hewlett-Packard LaserJet printer spooler daemon

/uussrr/lliibb/hhppdd

#hpr
hhpprr -- Send file to Hewlett-Packard LaserJet printer spooler

hhpprr [-BBcceemmnnrr] [-bb _b_a_n_n_e_r] [ -ff _f_o_n_t_n_u_m] [_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -BB        Suppress banner page and extra page at termination.  _M_u_s_t be
               used with a PostScript printer.
     -bb        Next argument is the banner
     -cc        Make a copy of each _f_i_l_e in spool area
     -ee        Erase all fonts from printer's memory
     -ff _f_o_n_t_n_u_m _f_i_l_e_1 ... _f_i_l_e_N
               Load into printer memory the HP soft fonts in _f_i_l_e_1 through
               _f_i_l_e_N; set font identifiers beginning with _f_o_n_t_n_u_m
     -mm        Send a message when listing is complete
     -nn        No message (default)
     -rr        Remove files when they have been spooled
#hpskip
hhppsskkiipp -- Abort/restart current listing on Hewlett-Packard LaserJet

hhppsskkiipp [-rr]

_O_p_t_i_o_n:
     -rr        Restarts the current listing
#icheck
iicchheecckk -- i-node consistency check

iicchheecckk [-ss] [-bb _N ...] [ -vv ] _f_i_l_e_s_y_s_t_e_m ...

_O_p_t_i_o_n_s:
     -bb        The following numeric arguments give block numbers; all
               references to these blocks are printed, with type
     -ss        Repair file system (requires write access)
     -vv        Print summary of information about file system
#if
iiff -- Execute a command conditionally

iiff _s_e_q_u_e_n_c_e_1 tthheenn _s_e_q_u_e_n_c_e_2 [eelliiff _s_e_q_u_e_n_c_e_3 tthheenn _s_e_q_u_e_n_c_e_4] ... [eellssee _s_e_q_u_e_n_c_e_5] ffii

Each tthheenn, eelliiff, eellssee, and ffii must occur unquoted at the start of a line or
preceded by `;'.  The shell executes iiff directly.
#infocmp
iinnffooccmmpp -- De-compile a terminfo file

iinnffooccmmpp [_f_i_l_e ... ]

#init
iinniitt -- System initialization

/eettcc/iinniitt

init -- System initialization Usage:    /etc/init
#install
iinnssttaallll -- Install a software update onto COHERENT

/eettcc/iinnssttaallll _i_d _d_e_v_i_c_e _n_d_i_s_k_s

_A_r_g_u_m_e_n_t_s:
     _i_d        String that identifies the release; e.g., ccoohh.330011 identifies
               COHERENT release version 3.0.1.
     _d_e_v_i_c_e    The physical device from which the installation takes place;
               e.g., /ddeevv/ffhhaa00 identifies floppy-disk drive 0 (drive A), where
               it is a high-density, 5.25-inch disk.
     _n_d_i_s_k_s    Number of floppy disks in the release.
#jobs
jjoobbss -- Print information about jobs

jjoobbss

kksshh only.
#join
jjooiinn -- Join two data bases

jjooiinn [-aa [_n] ] [-ee _s_t_r_i_n_g ] [-jj[_n] _k_e_y_f] [-oo _n._m ...] [-tt_c] _f_i_l_e_1 _f_i_l_e_2

_O_p_t_i_o_n_s:
     -aa[_n]     Print unpaired records from file _n
     -ee _s      Replace empty fields on output with string _s
     -jj[_n] _k_e_y Use _k_e_y of file _n for comparison
     -oo [_n.]_m ..
               Subsequent arguments list fields to output; each has file _n and
               field number _m
     -tt_c       Field separator is character _c

If either _f_i_l_e_1 or _f_i_l_e_2 is `-', stdin is used.  The optional file _n may be
either 1 or 2; if omitted, both 1 and 2 are assumed.
#kermit
kkeerrmmiitt -- Inter-system communication and file transfer

kkeerrmmiitt cc[bbeellLL _b_a_u_d _e_s_c _l_i_n_e]
kkeerrmmiitt rr[bbddffhhiillLLtt _b_a_u_d _l_i_n_e]
kkeerrmmiitt ss[aabbddffhhiillLLmmttxx _b_a_u_d _l_i_n_e] _f_i_l_e ...

_M_o_d_e_s:
     cc         Connect
     rr         Receive
     ss         Send
_O_p_t_i_o_n_s:
     aa         Specify path for sending and receiving files
     bb _b_a_u_d    Use given baud rate
     dd         Print debug information
     ee _e_s_c     Use _e_s_c as escape character (default, `^')
     ff         Suppress file-name conversion
     hh         Host mode
     ii         Image mode (for non-ASCII transfer)
     ll _l_i_n_e    Use given line
     LL         Log all commands into file LLoogg
     mm         Macintosh mode
     tt         Tymnet mode
     xx         Use complete path name for receiving file
_C_o_m_m_a_n_d_s:
     _e_s_ccc      Exit from kkeerrmmiitt
     _e_s_css      Suspend kkeerrmmiitt
#kill
kkiillll -- Signal a process

kkiillll [- _s_i_g_n_a_l ] _p_i_d ...

#ksh
kksshh -- The Korn shell

kksshh _t_o_k_e_n ...

#l
ll -- List directory's contents in long format

ll [_f_i_l_e ...]

#lc
llcc -- List directory's contents in columnar format

llcc [ -11aabbccddffpp ] [ _d_i_r_e_c_t_o_r_y ...]

_O_p_t_i_o_n_s:
     -11        List files one per line instead of in columns
     -aa        List all files in directory (including `.' and `..')
     -bb        List block-special files only
     -cc        List character-special files only
     -dd        List directories only
     -ff        List regular files only
     -pp        List pipe files only

Options can be combined.  If no _d_i_r_e_c_t_o_r_y is specified, the current directory
is used.
#ld
lldd -- Link relocatable object modules

lldd [_o_p_t_i_o_n ...] _f_i_l_e ...

_O_p_t_i_o_n_s:
     -dd        Define commons (even if undefined symbols).  COHERENT 286 only.
     -ee _e_n_t    Set entry point to symbol or octal number
     -ff        (Force) Force link even if there are errors
     -ii        Bind output sepid
     -KK        Rebuilt a new kernel.
     -LL_d_i_r_e_c_t_o_r_y
               Search _d_i_r_e_c_t_o_r_y for libraries and objects before searching the
               directories named in the environmental variable LLIIBBPPAATTHH
     -ll_l_i_b     Use standard library _l_i_b
     -oo _f_i_l_e   Write output into _f_i_l_e (default, _l._o_u_t)
     -qq        (Quiet) Suppress all warning messages
     -QQ        Quiet: Suppress all error messages
     -rr        Retain relocation information
     -ss        Discard symbol table
     -uu _s_y_m    Undefine _s_y_m (force library search)
     -xx        Discard all local symbols
     -XX        Discard C internal local symbols
#let
lleett -- Evaluate an expression

lleett [_e_x_p_r_e_s_s_i_o_n]

kksshh only.
#lex
lleexx -- Lexical analyzer generator

lleexx [-tt][-vv][_f_i_l_e]
cccc lleexx.yyyy.cc -llll

_O_p_t_i_o_n_s:
     -tt        Write to standard output instead of lleexx.yyyy.cc
     -vv        Give statistics about generated tables
#lf
llff -- List directory's contents in columnar format

llff [_f_i_l_e ...]

#lines
lliinneess -- Highly amusing board game

/uussrr/ggaammeess/lliinneess

#ln
llnn -- Create a link to a file

llnn [-ff] _o_l_d_f_i_l_e _n_e_w_f_i_l_e
llnn [-ff] _o_l_d_f_i_l_e ... _d_i_r_e_c_t_o_r_y

_O_p_t_i_o_n:
     -ff        Force link even if _n_e_w_f_i_l_e exists
#login
llooggiinn -- Log in or change user name

llooggiinn [_u_s_e_r_n_a_m_e]

#logmsg
llooggmmssgg -- Hold COHERENT Login Message

/eettcc/llooggmmssgg

#look
llooookk -- Find matching lines in a sorted file

llooookk [-ddff] _s_t_r_i_n_g [_f_i_l_e]

_O_p_t_i_o_n_s:
     -dd        Dictionary ordering
     -ff        Fold cases for comparison

If no _f_i_l_e, llooookk uses /uussrr/ddiicctt/wwoorrddss with -ddff option.
#lpd
llppdd -- Line printer spooler daemon

/uussrr/lliibb/llppdd

#lpr
llpprr -- Send to line printer spooler

llpprr [-ccmmnnrr] [-bb _b_a_n_n_e_r] [_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -BB        Suppress printing of a banner.  This option mmuusstt be used with
               PostScript printers.
     -bb        Next argument is the banner
     -cc        Copy each _f_i_l_e in spool area
     -mm        Send a message when listing is complete
     -nn        No message (default)
     -rr        Remove files when they have been spooled
#lpskip
llppsskkiipp -- Terminate/restart current line printer listing

llppsskkiipp [-rr]

_O_p_t_i_o_n:
     -rr        Restart current listing

With no argument, terminate current listing.
#lr
llrr -- List subdirectories' contents in columnar format

llrr [_f_i_l_e ...]

#ls
llss -- List directory's contents

llss [-aabbCCccddFFffggiillmmnnooppqqRRrrssttuuxx] [_f_i_l_e ... ]

_O_p_t_i_o_n_s:
     -aa        List all files (including `.' and `..')
     -bb        Print non-graphic characters in octal
     -CC        Print output in multi-column format, sorted down the columns
     -cc        Use attribute change instead of modified time for -ll and -tt
     -dd        Treat directories like files
     -FF        Print `/' after directories and `*' after executables
     -ff        Treat _f_i_l_e as a directory even if it is not
     -ii        Print the i-number as well
     -ll        Long format: show file type, permissions, size
     -mm        Output file names separated by commas
     -nn        Same as -ll
     -pp        Print `/' after directory names
     -qq        Print non-graphic characters as `?'
     -RR        Recursively display directories
     -rr        Reverse the order of all sorting
     -ss        Print the file size in blocks as well
     -tt        Sort by times, newest first
     -uu        Use accessed rather than modified time
     -xx        Print multicolumn output, sorted across the columns
#lx
llxx -- List directory's contents in columnar format

llxx [_f_i_l_e ...]

#m4
mm44 -- Macro processor

mm44 [ffiillee ...]

If _f_i_l_e is `-' or omitted, mm44 reads the standard input.
#mail
mmaaiill -- Computer mail

mmaaiill [-mmppqqrrvv] [-ff _f_i_l_e] [_u_s_e_r ...]

_O_p_t_i_o_n_s:
     -ff _f_i_l_e   Print mail from _f_i_l_e instead of default
     -mm        Notify each logged-in recipient when mail is sent
     -pp        Print mail non-interactively
     -qq        Exit on interrupt, leaving mail unchanged
     -rr        Print mail in reverse order
     -vv        Verbose mode: show version and expanded aliases

If _u_s_e_r is present, send each a mail message read from standard input.  Mail
message ends with EOF, a line containing only `.', or a line containing only
`?'; the last moves the message into editor for further editing processing
before transmission.
_C_o_m_m_a_n_d_s:
     dd         Delete current message; print the next
     mm [_u_s_e_r ...]
               Mail current message to each _u_s_e_r
     pp         Print this message again
     qq         Quit and update mailbox
     rr         Reverse direction of scan through mailbox
     ss [_f_i_l_e ...]
               Save current message with header in each _f_i_l_e
     tt [_u_s_e_r ...]
               Send message from stdin to each _u_s_e_r
     ww  [_f_i_l_e ...]
               Write current message without header in each _f_i_l_e
     xx         Exit without updating mailbox
     <nneewwlliinnee> Print the next message
     -         Print the previous message
     EOF       Quit and update mailbox; same as qq command
     ?         Print a command summary
     !_c_o_m_m_a_n_d  Pass _c_o_m_m_a_n_d to the shell for execution
#make
mmaakkee -- Program building discipline

mmaakkee [_o_p_t_i_o_n ...] [_a_r_g_u_m_e_n_t ...] [_t_a_r_g_e_t ...]

_O_p_t_i_o_n_s:
     -dd        Debug mode
     -ee        Macro definitions in environment override those in makefile
     -ff _f_i_l_e   Instructions are in _f_i_l_e (default, [mmMM]aakkeeffiillee)
     -ii        Ignore command error returns
     -nn        Test: do all but execute commands
     -pp        Print macro definitions and target descriptions
     -qq        Only return exit status (zero if files up to date)
     -rr        Ignore built-in rules
     -ss        Do not print command lines when executed
     -tt        Update times of files without regenerating
#man
mmaann -- Print Lexicon entries

mmaann [-ww] [_t_o_p_i_c ...]

_O_p_t_i_o_n_s:
     -ww        Print only file name where document resides

With no arguments, list available topics.
#me
mmee -- MicroEMACS screen editor

mmee [-ee _e_r_r_o_r_f_i_l_e] [-ff _b_i_n_d_f_i_l_e] [_t_e_x_t_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -ee _e_r_r_o_r_f_i_l_e
               Error-handling mode; read error messages from _e_r_r_o_r_f_i_l_e
     -ff _b_i_n_d_f_i_l_e
               Read keyboard bindings from _b_i_n_d_f_i_l_e
#mesg
mmeessgg -- Permit/deny messages from other users

mmeessgg [nnyy]

_O_p_t_i_o_n_s:
     nn         Disallow messages
     yy         Allow messages

With no arguments, mmeessgg prints the state.
#mkdir
mmkkddiirr -- Create a directory

mmkkddiirr [ -rr ] _d_i_r_e_c_t_o_r_y

_O_p_t_i_o_n:
     -rr        Make parent directories recursively as required
#mkfnames
mmkkffnnaammeess -- Generate data base of user names

mmkkffnnaammeess [_n_a_m_e_f_i_l_e  ...]

#mkfs
mmkkffss -- Make a new file system

/eettcc/mmkkffss [-bb _b_o_o_t] [-dd] [-ff _n_a_m_e] [-ii _i_n_o_d_e_s] [-mm _a_r_g] [-nn _a_r_g] [-pp _p_a_c_k] _f_i_l_e_s_y_s_t_e_m _p_r_o_t_o

_O_p_t_i_o_n_s:
     -bb _b_o_o_t   Specifies the file to use as the ``bootstrap'' for the file
               system.
     -dd        Preserve file dates and times.
     -ff _n_a_m_e   Label the file system with the given _n_a_m_e.  _n_a_m_e must be less
               than seven characters in length.
     -ii _i_n_o_d_e_s Use _i_n_o_d_e_s as the number of inodes for the file system.
     -mm _a_r_g    Number of blocks to skip when incrementing virtual block number
     -nn _a_r_g    Size of a ``virtual cylinder''
     -pp _p_a_c_k   Set the file system ``pack name'' to _p_a_c_k.  _p_a_c_k must be less
               than seven characters in length.

If _p_r_o_t_o is a number, it is the size in blocks of an empty file system;
otherwise, it names a prototype description file, as created by the command
bbaaddssccaann.
#mknod
mmkknnoodd -- Make a special file or named pipe

/eettcc/mmkknnoodd [ -ff ] _f_i_l_e_n_a_m_e _t_y_p_e _m_a_j_o_r _m_i_n_o_r
/eettcc/mmkknnoodd [ -ff ] _f_i_l_e_n_a_m_e pp

_O_p_t_i_o_n
     -ff        Forces creation of a new node, even if one of same name already
               exists

In first form of the command, _t_y_p_e is `b' for block special or `c' for
character special; _m_a_j_o_r and _m_i_n_o_r are numbers.  The second form creates a
named pipe with the given _f_i_l_e_n_a_m_e.
#modemcap
mmooddeemmccaapp -- Modem-description language

/eettcc/mmooddeemmccaapp

#modeminit
mmooddeemmiinniitt -- Initialize a modem

/uussrr/bbiinn/mmooddeemmiinniitt

#moo
mmoooo -- Greatly amusing numeric guessing game

/uussrr/ggaammeess/mmoooo [ _n_u_m_d_i_g_i_t_s ]

#more
mmoorree -- Display text one page at a time

mmoorree [ -ccddffllssuu ] [ -_w_i_n_d_o_w__s_i_z_e ] [ +_l_i_n_e__n_u_m_b_e_r ] [ +/_p_a_t_t_e_r_n ] [ _f_i_l_e ... ] [ - ]

_O_p_t_i_o_n_s:
     -         Read/display stdin
     -cc        Paint screen from top down
     -dd        Prompt user to quit after each screenful of text
     -ff        Count lines from file rather than screen-display lines
     -ll        Do not treat <ccttrrll-LL> as special
     -ss        Squeeze consecutive blank lines into one
     -uu        Display backspaces as control characters
     +lliinnee_nnuummbbeerr
               Begin display at _l_i_n_e__n_u_m_b_e_r
     +/ppaatttteerrnn Begin display at first line to contain _p_a_t_t_e_r_n
#motd
mmoottdd -- File that holds message of the day

/eettcc/mmoottdd

#mount.all
mmoouunntt.aallll -- Mount file systems at boot time

/eettcc/mmoouunntt.aallll

#mount
mmoouunntt -- Mount a file system

/eettcc/mmoouunntt [ _s_p_e_c_i_a_l _d_i_r_e_c_t_o_r_y [ -rruu ] ]

_O_p_t_i_o_n_s:
     -rr        Mount device read-only
     -uu        Update /eettcc/mmttaabb entry but do not mount device

With no arguments, print devices currently mounted.  _s_p_e_c_i_a_l names a device-
special file; _d_i_r_e_c_t_o_r_y names the directory on which to mount it.  File
/bbiinn/mmoouunntt contains useful abbreviations for invoking /eettcc/mmoouunntt.
#msg
mmssgg -- Send a brief message to other users

mmssgg _u_s_e_r
_m_e_s_s_a_g_e

#msgs
mmssggss -- Read messages intended for all COHERENT users

mmssggss [-_q] [_n_u_m_b_e_r]

_O_p_t_i_o_n_s:
     -qq        Query if new message is waiting to be read
     _n_u_m_b_e_r    Print message titled with given _n_u_m_b_e_r

To submit a message to mmssggss, mail it to user mmssggss.
#mv
mmvv -- Rename files or directories

mmvv [-ff] _o_l_d_f_i_l_e [_n_e_w_f_i_l_e]
mmvv [-ff] _f_i_l_e ... _d_i_r_e_c_t_o_r_y

_O_p_t_i_o_n:
     -ff        Force: remove _n_e_w_f_i_l_e even if unwritable
#mvdir
mmvvddiirr -- Rename a directory

/eettcc/mmvvddiirr _o_l_d_d_i_r _n_e_w_d_i_r

#ncheck
nncchheecckk -- Print file names corresponding to i-node

nncchheecckk [ -ii _n_u_m_b_e_r ... ] [ -aass ] _f_i_l_e_s_y_s_t_e_m ...

_O_p_t_i_o_n_s:
     -aa        Print file names including `.' and `..'
     -ii _n...   Print file names only for listed i-numbers _n...
     -ss        Print only special files and files with setuid mode
#newgrp
nneewwggrrpp -- Change to a new group

nneewwggrrpp _g_r_o_u_p

#newusr
nneewwuussrr -- Add new user to COHERENT system

/eettcc/nneewwuussrr _l_o_g_i_n "_U_s_e_r _N_a_m_e" _p_a_r_e_n_t_d_i_r [ _s_h_e_l_l ]

#nm
nnmm -- Print a program's symbol table

nnmm [ -aaddggnnoopprruu ] _f_i_l_e ...

_O_p_t_i_o_n_s:
     -aa        Print all symbols
     -dd        Print only definitions
     -gg        Print only global symbols
     -nn        Sort numerically (default, sort by name)
     -oo        Prepend file or member name to each line
     -pp        Print in symbol table order (no sort)
     -rr        Reverse order of sort
     -uu        Print undefined symbols

_f_i_l_e may be an object file or an archive.
#nptx
nnppttxx -- Generate permutations of users' full names

nnppttxx

#nroff
nnrrooffff -- Text-formatting language

nnrrooffff [_o_p_t_i_o_n ...] [_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -dd        Debug: print each request before executing
     -ff _n_a_m_e   Write temporary file in file _n_a_m_e
     -ii        Read stdin after each _f_i_l_e has been read
     -kk        Keep temporary file
     -mm_n_a_m_e    Read macro package /uussrr/lliibb/ttmmaacc._n_a_m_e
     -nn_N       Number first page of output _N (default, 1)
     -rr_a_N      Set number register _a to value _N
     -rr_a_b_N     Set number register _a_b to value _N; for obvious reasons, _a_b
               cannot contain a digit
     -xx        Do not eject to bottom of final page
#od
oodd -- Print an octal dump of a file

oodd [-bbccddooxx] [_f_i_l_e] [ [+] _o_f_f_s_e_t[.][bb] ]

_O_p_t_i_o_n_s:
     -bb        Dump bytes in the default base
     -cc        Dump bytes as ASCII characters
     -dd        Dump words in decimal
     -oo        Dump words in octal
     -xx        Dump words in hexadecimal

Default base is octal on the PDP-11; hexadecimal on the i80286, Z-8001, and
M68000.  _o_f_f_s_e_t must be preceded by `+' if _f_i_l_e is omitted.  _o_f_f_s_e_t is decimal
if `.' is present; `b' implies 512-byte blocks instead of bytes.
#passwd
ppaasssswwdd -- Set/change login password

ppaasssswwdd [_u_s_e_r]

#paste
ppaassttee -- Merge lines of files

ppaassttee [-ss] [-dd _l_i_s_t] _f_i_l_e ...

_O_p_t_i_o_n_s:
     -ss        Display lines of input files sequentially across page
     -dd _l_i_s_t   Use _l_i_s_t as delimiters for output fields
#patch
ppaattcchh -- Modify portions of an executable

/ccoonnff/ppaattcchh [-kk] _i_m_a_g_e _s_y_m_b_o_l=_v_a_l_u_e ...

_O_p_t_i_o_n_s:
     -kk        Patch the kernel's data memory of the running system via device
               /ddeevv/kkmmeemm.
#pax
ppaaxx -- Portable archive interchange


The options are the same as those for the command ttaarr.
#phone
pphhoonnee -- Print numbers and addresses from phone directory

pphhoonnee _p_e_r_s_o_n ...

#popd
ppooppdd -- Pop an item from the directory stack

ppooppdd [_i_t_e_m ... ]

sshh only.
#pr
pprr -- Paginate and print files

pprr [ _o_p_t_i_o_n_s ] [ _f_i_l_e ...]

_O_p_t_i_o_n_s:
     +_s_k_i_p     Skip the first _s_k_i_p pages of input before printing
     -_c_o_l_s     Print the input in _c_o_l_s columns
     -hh        The next argument is the header (replaces file name)
     -ll_n       Set page size to _n lines (default, 66)
     -mm        Print each input _f_i_l_e in a separate column
     -nn        Number the output lines
     -ss_c       Separate each column with character _c
     -tt        Suppress top and bottom margins and header
     -ww_n       Page width is set to _n columns (default, 80)

A _f_i_l_e named `-' means stdin.
#prep
pprreepp -- Produce a word list

pprreepp [ -ddffpp ] [ -ii _i_f_i_l_e ] [ -oo _o_f_i_l_e ] [ _f_i_l_e ... ]

_O_p_t_i_o_n_s:
     -dd        Print number of each word output
     -ff        Fold upper case to lower case
     -ii _f_i_l_e   Ignore all words in _f_i_l_e on output
     -oo _f_i_l_e   Output only words from _f_i_l_e
     -pp        Print punctuation marks on separate lines (not numbered)

Text is taken from each input _f_i_l_e or stdin if none.  Words consist of
alphabetic characters and apostrophes.
#print
pprriinntt -- Echo text onto the standard output

pprriinntt [-eennrruu_n] [_a_r_g_u_m_e_n_t ...]

_O_p_t_i_o_n_s:
     -ee        Re-enable expansion of C escape sequences
     -nn        Don't print newline after list of arguments
     -rr        Suppress expansion of C escape sequences
     -uu_n       Redirect output file descriptor _n

kksshh only.
#prof
pprrooff -- Print execution profile of a C program

pprrooff [ -aabbccss ][ _p_r_o_g_f_i_l_e [ _m_o_n_f_i_l_e ] ]

_O_p_t_i_o_n_s:
     -aa        Use all symbols, not just externals
     -bb        Print all bin information
     -cc        Print all call information
     -ss        Report stack usage high water mark

The default _p_r_o_g_f_i_l_e is ll.oouutt; the default _m_o_n_f_i_l_e, mmoonn.oouutt.
#profile
pprrooffiillee -- Set user's environment at login

/eettcc/pprrooffiillee

#.profile
.pprrooffiillee -- Set user's personal environment at login

$HHOOMMEE/.pprrooffiillee

#prps
pprrppss -- Prepare files for PostScript-compatible printer

pprrppss [_o_p_t_i_o_n_s] [_f_i_l_e ... ]

_O_p_t_i_o_n_s:
     -_p_t_s_i_z_e   Use _p_t_s_i_z_e as the point size (default, 10)
     -bb        Suppress the box around the page text
     -ff_f_o_n_t    Use the given font name (default, Courier)
     -FF_X       Use font X, which must be [ABHNPST]
     -FF_s_f_x     Use _s_f_x as suffix for font X, which must be [RRBBII].  Default
               suffixes are "" (R), -BBoolldd (B), -OObblliiqquuee (I)
     -hh        Suppress the header line
     -ll        Landscape mode (default, portrait)
     -ll22       Landscape mode, two pages per output page
     -nn_h_e_a_d    Use _h_e_a_d in header line
     -pp_N       Print _N lines of text per output page
     -tt_N       Set tab stops to every _N characters (default, 8)
     +_N        Skip first _N output pages
#ps
ppss -- Print process status

ppss [ -aaffggllmmnnrrttwwxx ] [ -cc _s_y_s ] [ -kk _m_e_m ]

_O_p_t_i_o_n_s:
     -aa        Print all terminals' processes
     -cc _s_y_s    Next argument is system (default, /ccoohheerreenntt)
     -dd        Print status of loadable drivers
     -ff        Put `-' in null fields for placeholders
     -gg        Give group leader for this process
     -kk _m_e_m    Next argument is memory image (default, /ddeevv/mmeemm)
     -ll        Print long format
     -mm        Print scheduling information
     -nn        No header line
     -rr        Give the real size of the process
     -tt        Print CPU times
     -ww        Wide column format (132 columns instead of default 80)
     -xx        Print processes with no controlling tty
#pushd
ppuusshhdd -- Push an item onto the directory stack

ppuusshhdd [_d_i_r_e_c_t_o_r_y_0 ... _d_i_r_e_c_t_o_r_y_N]

sshh only.
#pwd
ppwwdd -- Print the name of the current directory

ppwwdd

#qfind
qqffiinndd -- Quickly find all files with a given name

qqffiinndd [-aaddpp] _n_a_m_e ...
qqffiinndd [-bb]

_O_p_t_i_o_n_s:
     -aa        All: search for files or directories
     -bb        Build file data base
     -dd        Search for directories only
     -pp        Partial name matching

Run as rroooott when using -bb to find everything.
#quot
qquuoott -- Summarize file-system usage

qquuoott [ -cc ] [ -ff ] [ -nn ] [ -tt ] _f_i_l_e_s_y_s_t_e_m

_O_p_t_i_o_n_s:
     -cc        Print file size, number of files of size, and cumulative total
               blocks up to size
     -ff        Print number of files plus number of blocks per user
     -nn        Input (i-number, file system) pairs one per line; output owners
               and file names (e.g.: nncchheecckk ffss | ssoorrtt +00nn | qquuoott -nn ffss)
     -tt        Print totals (where applicable)

Options -cc and -nn are disjoint from other options.  Only the superuser rroooott can
run qquuoott.
#ramdisk
rraammddiisskk -- Script to create a RAM-disk

/uussrr/bbiinn/rraammddiisskk

#ranlib
rraannlliibb -- Create index for object library

rraannlliibb _l_i_b_r_a_r_y ...

#rc
rrcc -- Perform standard maintenance chores

/eettcc/rrcc

#read
rreeaadd -- Assign values to shell variables

rreeaadd _n_a_m_e ...

Reads a line from stdin and assign each token to corresponding shell variable
_n_a_m_e.  The shell executes rreeaadd directly.
#readonly
rreeaaddoonnllyy -- Mark a shell variable as read only

rreeaaddoonnllyy

#reboot
rreebboooott -- Reboot the COHERENT system

/eettcc/rreebboooott [ -pp ]

_O_p_t_i_o_n:
     -pp        Prompt user if she really wishes to reboot
#ref
rreeff -- Display a C function header

rreeff _f_u_n_c_t_i_o_n

#restor
rreessttoorr -- Restore file system

rreessttoorr _c_o_m_m_a_n_d [_d_u_m_p__d_e_v_i_c_e] [_f_i_l_e_s_y_s_t_e_m] [_f_i_l_e ...]

_O_p_t_i_o_n_s:
     ff         Next argument names the dump device
     rr         Mass restore (also RR)
     tt         Print taken and since dates of the dump
     vv         Verbose (print commentary during mass restore)
     xx         Selective extract of argument files (also `X')
#rev
rreevv -- Print text backwards

rreevv [_f_i_l_e ...]

#rm
rrmm -- Remove files

rrmm [ -ffiirrttvv ] _f_i_l_e ...

_O_p_t_i_o_n_s:
     -ff        Force: remove unwritable files, suppress error messages and
               prompts
     -ii        Ask before removing each file
     -rr        Recursively remove entire directory structure
     -tt        Test: perform all checks but do not remove files
     -vv        Verbose: report the disposition of each file
#rmail
rrmmaaiill -- Receive UUCP mail

rrmmaaiill [-LLllRRrr] -qq _n_u_m -uu _u_u_x_f_l_a_g_s _a_d_d_r_e_s_s ...

_O_p_t_i_o_n_s:
     -LL        Send all addresses to the local mailer for processing
     -ll        Send a domain address to the local mailer for processing
     -qq _n_u_m    Reset the queueing threshold to _n_u_m
     -RR        Reroute UUCP paths
     -rr        Route the first component of a UUCP path in addition to routing
               domain addresses
     -uu _u_u_x_f_l_a_g_s
               Pass _u_u_x_f_l_a_g_s to uuuuxx
#rmdir
rrmmddiirr -- Remove directories

rrmmddiirr [ -ff ] _d_i_r_e_c_t_o_r_y ...

_O_p_t_i_o_n:
     -ff        Force: remove a file without interactive checking
#rubik
rruubbiikk -- Play Rubik's cube

/uussrr/ggaammeess/rruubbiikk

#sa
ssaa -- Print a summary of process accounting

ssaa [-aabbccjjllmmnnrrssttuu] [-vv _N] [_f_i_l_e]

_O_p_t_i_o_n_s:
     -aa        Commands seen once or unprintable called ***ootthheerr
     -bb        Sort by average CPU time per call
     -cc        Print CPU time as percentage of all CPU time used
     -jj        Print average times per call, not totals
     -ll        Separate user and system times
     -mm        Information per user, not per command
     -nn        Sort by number of calls
     -rr        Reverse sort
     -ss        Condense the information
     -tt        Print CPU time as percentage of real time
     -uu        Print user and command directly from raw file
     -vv_N       If called no more than _N times, put it into **jjuunnkk**

The default _f_i_l_e is /uussrr/aaddmm/aacccctt.
#scat
ssccaatt -- Print text files one screenful at a time

ssccaatt [ [_o_p_t_i_o_n ...] [_f_i_l_e ... ] ] ...

_O_p_t_i_o_n_s:
     -11        Do not stop at EOF if exactly one file specified
     -bb_n       Begin output at line _n
     -cc        Mark control characters (overrides -tt)
     -ccss       Like -cc, but map space to underscore `_', and prefix underscore
               with `\'
     -cctt       Like -cc, but map tabs to spaces
     -iinn       Skip _n columns on output
     -llnn       Set screen length to _n lines
     -nn        Number input lines
     -rr        Remote; no paging
     -ss        Squash empty lines
     -SS_n       Seek _n bytes into input before processing
     -tt        Truncate lines to line length (default, wraparound)
     -ww_n       Set screen width to _n columns
     -xx        Expand tabs
_C_o_m_m_a_n_d_s:
     <rreettuurrnn>  Next page
     <ssppaaccee>   Next line
     /         Next half page
     ff         Print file names and line number
     nn         Next file
     qq         Quit
#sed
sseedd -- Stream editor

sseedd [ -nn ] [-ee _c_o_m_m_a_n_d] [-ff _s_c_r_i_p_t] ... _f_i_l_e ...

_O_p_t_i_o_n_s:
     -ee        Direct command follows
     -ff        File name of command script follows
     -nn        No implicit output
#set
sseett -- Set shell option flags and positional parameters

sseett [-cceeiikknnssttuuvvxx [_n_a_m_e ...] ] (Bourne shell)
sseett [[+-]aaeeffhhkkmmnnuuvvxx] [[+-]oo _n_a_m_e] (Korn shell)

_O_p_t_i_o_n_s:
     -aa        Automatically export all new variables (kksshh)
     -cc _s_t_r_i_n_g Read commands from _s_t_r_i_n_g (sshh)
     -ee        Exit on any error
     -ff        Noglob:  Don't expand file names (kksshh)
     -hh        Automatically add all commands to hash table (kksshh)
     -ii        Shell is always interactive (sshh)
     -kk        Place all keyword arguments into environment (sshh)
     -kk        Recognize variables anywhere in command (kksshh)
     -mm        Enable job control (kksshh)
     -nn        Read commands but do not execute
     -oo _o_p_t_i_o_n Set _o_p_t_i_o_n (kksshh)
     -ss        Read commands from stdin; write to stderr (sshh)
     -tt        Read one command rather than entire file (sshh)
     -uu        If variable is blank, report error
     -vv        Print each line as it is read
     -xx        Print each command as it's executed
     -         Cancel -vv and -xx options (sshh)

With kksshh, prefixing an option with `+' turns it on; prefixing it with `-' turns
it off.
#sh
sshh -- The Bourne shell

sshh [-cceeiikknnssttuuvvxx] _t_o_k_e_n ...

_O_p_t_i_o_n_s:
     -cc _c_m_d_s   Read commands from _c_m_d_s
     -ee        Exit on any error if noninteractive
     -ii        Interactive even if no tty attached
     -kk        Place all keyword args into global environment
     -nn        Read commands but do not execute them
     -ss        Read commands from stdin, write output to stderr
     -tt        Read and execute one command only
     -uu        Report error if actual value of shell variable is null
     -vv        Print each line as read
     -xx        Print each command and argument as executed
     -         Cancel -vv and -xx options

The following reserved tokens may not be used in the first position of the
command unless quoted:

        ccaassee ddoo ddoonnee eelliiff eellssee ffii ffoorr iinn tthheenn uunnttiill wwhhiillee { } ( )

If the first token is not reserved, it is treated as the name of a command.
The remaining tokens are treated as arguments.  The characters * ? [ ] specify
patterns that match file names.  To quote characters or strings, these escape
characters are provided:

        '...' "..." \

Each _t_o_k_e_n, unless quoted, is checked for substitutions.
#shift
sshhiifftt -- Shift positional parameters

sshhiifftt

The shell executes sshhiifftt directly.
#shutdown
sshhuuttddoowwnn -- Shut down the COHERENT system

/eettcc/sshhuuttddoowwnn

#size
ssiizzee -- Print size of an object file

ssiizzee [_f_i_l_e ...]

#sleep
sslleeeepp -- Stop executing for a specified time

sslleeeepp _s_e_c_o_n_d_s

#smail
ssmmaaiill -- Send UUCP mail

ssmmaaiill [-AAccddLLllRRrrvv] -aa _a_l_i_a_s_f_i_l_e -FF _a_d_d_r_e_s_s -HH [_h_o_s_t_d_o_m_a_i_n] \
        -hh [_h_o_s_t] -mm _n_u_m -nn [_n_a_m_e_l_i_s_t] -pp _p_a_t_h_f_i_l_e \
        -qq _n_u_m -uu _u_u_x_f_l_a_g_s _a_d_d_r_e_s_s ...

_O_p_t_i_o_n_s:
     -AA        Print the resolved UUCP addresses; do not collect mail
     -aa _a_l_i_a_s_f_i_l_e
               Read _a_l_i_a_s_f_i_l_e
     -cc        Check /uussrr/lliibb/mmaaiill/ppaatthhss for the cost of mailing a message to a
               given host
     -dd        Give a verbose description; do not invoke other mailers
     -FF _a_d_d_r_e_s_s
               Use _a_d_d_r_e_s_s on the FFrroomm: line
     -HH _h_o_s_t_d_o_m_a_i_n
               Set the host's domain
     -hh _h_o_s_t_n_a_m_e
               Set a _h_o_s_t_n_a_m_e
     -LL        Send all addresses to the local mailer for processing
     -ll        Send a domain address to the local mailer for processing
     -mm _n_u_m    Send no more than _n_u_m jobs to uuuuxx
     -nn [_n_a_m_e_l_i_s_t]
               Use name-list style aliasing
     -pp _p_a_t_h_f_i_l_e
               Read _p_a_t_h_f_i_l_e instead of /uussrr/lliibb/mmaaiill/ppaatthhss
     -qq _n_u_m    Set the queuing threshold to _n_u_m
     -RR        Reroute UUCP paths
     -rr        Route the first component of a UUCP path in addition to routing
               domain addresses
     -uu _u_u_x_f_l_a_g_s
               Pass _u_u_x_f_l_a_g_s to uuuuxx
     -vv        Give verbose description, but invoke other mailers
#sort
ssoorrtt -- Sort lines of text

ssoorrtt [-bbccddffiimmnnrruu] [-tt _c] [-oo _o_u_t_f_i_l_e] [-TT _d_i_r] [+_b_e_g[-_e_n_d]][_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -cc        Check if input is already ordered
     -mm        Merge already-sorted input files
     -oo _n_a_m_e   Place output in _n_a_m_e, not stdout
     -tt_c       Tab character is _c
     -TT _d_i_r    Use _d_i_r for temporary files
     -uu        Output only records with unique keys
_K_e_y _o_p_t_i_o_n_s:
     -bb        Skip leading blanks in fields
     -dd        Dictionary ordering for keys
     -ff        Fold upper case into lower case in key comparison
     -ii        Ignore control characters in key comparison
     -nn        Numeric comparison
     -rr        Reverse sort ordering
_P_o_s_i_t_i_o_n:
     +_m._n_f     Key starts _m fields into record and _n characters into that
               field; _f may contain optional flags from key options above which
               apply only to that positional
     -_m._n_f     Optional ending position of key (same form as above)

If no _f_i_l_e is given, sort stdin.
#spell
ssppeellll -- Find spelling errors

ssppeellll [-aa][-bb][_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -aa        Use American variant of the dictionary (default)
     -bb        Use British variant of the dictionary
#split
sspplliitt -- Split a text file into smaller files

sspplliitt [-_n_l_i_n_e_s][-cc_c_o_u_n_t][_i_n_f_i_l_e [_o_u_t_f_i_l_e] ]

If _i_n_f_i_l_e _i_s `-' _o_r _n_o _i_n_f_i_l_e, stdin is read.  _o_u_t_f_i_l_e defaults to xx.  _n_l_i_n_e_s
is number of lines for text files, _c_o_u_n_t is the character count for binary
files.
#srcpath
ssrrccppaatthh -- Find source files

ssrrccppaatthh [-aaww] [-pp _p_a_t_h] _f_i_l_e_n_a_m_e _p_a_t_t_e_r_n ...

_O_p_t_i_o_n_s:
     -aa        Disable shadowing: print all instances of file it finds along
               SSRRCCPPAATTHH, not just first
     -pp _p_a_t_h   Use _p_a_t_h instead of SSRRCCPPAATTHH
     -ww        Print warning when you lack permission to read file or directory
#strings
ssttrriinnggss -- Print all character strings from a file

ssttrriinnggss [-ddooppxx] [-_l_e_n_g_t_h] [_f_i_l_e ... ]

_O_p_t_i_o_n_s:
     -dd        Print offset of each string in decimal
     -oo        Print offset of each string in octal
     -pp        Mask out the parity bit
     -xx        Print offset of each string in hexadecimal
#strip
ssttrriipp -- Strip tables from executable file

ssttrriipp -ddrrss _f_i_l_e [...]

_O_p_t_i_o_n_s:
     -dd        Keep debug information
     -rr        Keep relocation information
     -ss        Keep symbols
#stty
ssttttyy -- Set/print terminal modes

ssttttyy [_o_p_t_i_o_n ...]

_O_p_t_i_o_n_s:
     99660000      Baud rate: any valid terminal speed accepted
     00         Hang up phone immediately
     [bbrreeaakk|eeooff|eerraassee|iinntteerrrruupptt|kkiillll|qquuiitt|ssttaarrtt|ssttoopp] _c
               Set specified character to _c
     aallll       Display all modes
     ccbbrreeaakk    Enable break after every input character
     -ccbbrreeaakk   Disable break after every input character
     ccrrtt       Enable crt character erasing
     -ccrrtt      Disable crt character erasing
     eecchhoo      Enable input character echoing
     -eecchhoo     Disable input character echoing
     eevveenn      Enable even parity
     -eevveenn     Disable even parity
     eexxccll      Enable exclusive use
     -eexxccll     Disable exclusive use
     fflluusshh     Flush input queues
     -fflluusshh    Do not flush input queues
     hhuupp       Enable hang up on last close
     -hhuupp      Disable hang up on last close
     nnll        Disable newline mapping
     -nnll       Enable newline mapping
     oodddd       Enable odd parity
     -oodddd      Disable odd parity
     pprriinntt     Print terminal attributes
     rraaww       Enable raw mode
     -rraaww      Disable raw mode
     ssaannee      Set terminal to a known state
     ttaabbss      Disable tab expansion
     -ttaabbss     Enable tab expansion
     ttaannddeemm    Enable tandem (start/stop) mode
     -ttaannddeemm   Disable tandem (start/stop) mode

If no _o_p_t_i_o_n is specified, ssttttyy prints the modes of the standard-output device
on stderr.
#su
ssuu -- Substitute user id, become superuser

ssuu [_u_s_e_r [_c_o_m_m_a_n_d] ]

#sum
ssuumm -- Print checksum of a file

ssuumm [_f_i_l_e ...]

#sync
ssyynncc -- Flush system buffers

ssyynncc

#tail
ttaaiill -- Print the end of a file

ttaaiill [+_n[bbccffll]] [_f_i_l_e]
ttaaiill [-_n[bbccffll]] [_f_i_l_e]

_O_p_t_i_o_n_s:
     +_n        _n counts from beginning of file
     -_n        _n counts from end of file
     bb         _n is in blocks
     cc         _n is in characters (bytes)
     ff         Open tail of file, then display new material as it is added to
               the file.  File remains open until you type interrupt (usually
               <ccttrrll-CC>).
     ll         _n is in lines (default)
#tar
ttaarr -- V7 tape archive manager

ttaarr [ccrrttuuxx[00-77bbffllmmvvwwUU] [_b_l_o_c_k_s] [_a_r_c_h_i_v_e] _f_i_l_e ...

_D_i_r_e_c_t_i_v_e_s:
     cc         Create a new archive, overwriting any old contents
     rr         Replace (append) the named files in the archive
     tt         Write a table of contents of the archive to stdout
     uu         Update the archive (replace mode)
     xx         Extract the named files from the archive
_O_p_t_i_o_n_s:
     00-77       A single octal digit specifies a tape unit
     BB         Next argument is the blocking factor
     ff         Next argument is the archive name
     ll         Report broken links
     mm         Ignore the mmttiimmee for each extracted file
     UU         Tape written on a non-COHERENT system
     vv         Verbose flag
     ww         Interactive mode
#tee
tteeee -- Branch pipe output

tteeee [ -aa ] [ -ii ] [ _f_i_l_e ...]

_O_p_t_i_o_n_s:
     -aa        Append to each output _f_i_l_e
     -ii        Ignore interrupts
#termcap
tteerrmmccaapp -- Terminal-description language

/eettcc/tteerrmmccaapp

#terminfo
tteerrmmiinnffoo -- terminal description language

/uussrr/lliibb/tteerrmmiinnffoo

#test
tteesstt -- Evaluate conditional expression

tteesstt _e_x_p_r_e_s_s_i_o_n ...

_O_p_t_i_o_n_s:
     _e_x_p_1 -aa _e_x_p_2
               Both expressions are true
     -bb _f_i_l_e   _f_i_l_e is block-special (kksshh)
     -cc _f_i_l_e   _f_i_l_e is character-special (kksshh)
     -dd _f_i_l_e   _f_i_l_e is a directory
     _f_i_l_e_1 -eeff _f_i_l_e_2
               Files are identical (kksshh)
     _n_1 -eeqq _n_2 Numbers are equal
     -ff _f_i_l_e   _f_i_l_e exists and is not a directory
     -gg _f_i_l_e   _f_i_l_e has sseettggiidd bit set (kksshh)
     _n_1 -ggee _n_2 _n_1 is greater than or equal to _n_2
     _n_1 -ggtt _n_2 _n_1 greater than _n_2
     -kk _f_i_l_e   _f_i_l_e has sticky bit set (kksshh)
     -LL _f_i_l_e   _f_i_l_e is a symbolic link (kksshh)
     _n_1 -llee _n_2 _n_1 is less than or equal to _n_2
     _n_1 -lltt _n_2 _n_1 is less than _n_2
     -nn _s_t_r_i_n_g ssttrriinngg has non-zero length
     _n_1 -nnee _n_2 _n_1 does not equal _n_2
     _f_1 -nntt _f_2 _f_1 is newer than _f_2 (kksshh)
     _e_x_p_1 -oo _e_x_p_2
               Either _e_x_p_1 or _e_x_p_2 is true
     _f_1 -oott _f_2 _f_1 is older than _f_2 (kksshh)
     -pp _f_i_l_e   _f_i_l_e is a named pipe (kksshh)
     -rr _f_i_l_e   _f_i_l_e is readable
     -ss _f_i_l_e   _f_i_l_e exists and has nonzero length
     -tt [_f_d]   _f_d describes a terminal
     -uu _f_i_l_e   _f_i_l_e has sseettuuiidd set (kksshh)
     -ww _f_i_l_e   _f_i_l_e is writable
     -xx _f_i_l_e   _f_i_l_e is executable (kksshh)
     -zz _s_t_r_i_n_g _s_t_r_i_n_g has zero length
     _s_t_r_i_n_g    _s_t_r_i_n_g has non-zero length
     _s_1 = _s_2   _s_1 equals string _s_2
     ! _e_x_p     Negate logical value of _e_x_p
     _s_1 != _s_2  String _s_1 does not equal _s_2
     (_e_x_p)     Parentheses group expressions
#tic
ttiicc -- Compile a terminfo description

ttiicc [-vv[_n]] _s_o_u_r_c_e_f_i_l_e

_O_p_t_i_o_n:
     -vv        Verbose: Include debugging and tracing information.
#time
ttiimmee -- Time the execution of a command

ttiimmee [_c_o_m_m_a_n_d]

#times
ttiimmeess -- Print total user and system times

ttiimmeess

#touch
ttoouucchh -- Update modification time of a file

ttoouucchh [ -cc ] _f_i_l_e ...

_O_p_t_i_o_n:
     -cc        Do not create _f_i_l_e if it does not exist

The shell executes ttoouucchh directly.
#tr
ttrr -- Translate characters

ttrr [-ccddss] _s_t_r_i_n_g_1 [_s_t_r_i_n_g_2]

_O_p_t_i_o_n_s:
     -cc        Complement the characters in _s_t_r_i_n_g_1
     -dd        Delete characters found in _s_t_r_i_n_g_1 (_n_o _s_t_r_i_n_g_2 needed)
     -ss        Squeeze multiple output mappings onto one character

Both strings may contain ranges.  Characters may have form \_n_n_n.
#trap
ttrraapp -- Execute command on receipt of signal

ttrraapp [_c_o_m_m_a_n_d] [_n ...]

The shell executes _c_o_m_m_a_n_d on receipt of signal _n ....  If _c_o_m_m_a_n_d omitted, the
shell resets traps on given signals to original values.  If _c_o_m_m_a_n_d is a null
string, given signals are ignored.  If _n is zero, the shell executes _c_o_m_m_a_n_d
when it exits.  With no arguments, it prints currently set traps.  The shell
executes trap directly.
#troff
ttrrooffff -- Extended text-formatting language

ttrrooffff [_o_p_t_i_o_n ...] [_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -DD        Display available fonts
     -ff _n_a_m_e   Write temporary file in file _n_a_m_e
     -ii        Read stdin after each _f_i_l_e has been read
     -kk        Keep temporary file
     -ll        Landscape mode
     -mm_n_a_m_e    Read macro package /uussrr/lliibb/ttmmaacc._n_a_m_e
     -nn_N       Number first page of output _N (default, one)
     -pp        Produce PostScript output
     -rr_a_N      Set number register _a to value _N
     -rr_a_b_N     Set number register _a_b to value _N; for obvious reasons, _a_b
               cannot contain a digit
     -xx        Do not eject to bottom of final page
#true
ttrruuee -- Unconditional success

ttrruuee

#tsort
ttssoorrtt -- Topological sort

ttssoorrtt [_f_i_l_e]

#ttt
tttttt -- Play 3-D tic-tac-toe

/uussrr/ggaammeess/tttttt

#tty
ttttyy -- Print the user's terminal name

ttttyy

#ttystat
ttttyyssttaatt -- Get terminal status

/eettcc/ttttyyssttaatt [ -dd ] _p_o_r_t

_O_p_t_i_o_n:
     -dd        Print status of _p_o_r_t

Returns exit status 1 if specified port is enabled, 0 if disabled.  Prints
nothing unless -dd option specified.
#typeset
ttyyppeesseett -- Set/list variables and their attributes

ttyyppeesseett
ttyyppeesseett [+-]ffrr
ttyyppeesseett [ iirrxx ] _v_a_r_i_a_b_l_e=_v_a_l_u_e


_F_i_r_s_t _f_o_r_m: List all variables and their attributes
_S_e_c_o_n_d _f_o_r_m:
     +ff        List functions
     -ff        List functions plus values
     +rr        List read-only variables
     -rr        List read-only variables plus values

_T_h_i_r_d _f_o_r_m: Set _v_a_r_i_a_b_l_e to equal _v_a_l_u_e
     ii         Store _v_a_l_u_e as an integer
     rr         List read-only variables
     xx         Export _v_a_r_i_a_b_l_e=_f_R _t_o _e_n_v_i_r_o_n_m_e_n_t

kksshh only.
#typo
ttyyppoo -- Detect possible typographical and spelling errors

ttyyppoo [-nnrrss][_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -nn        Do not use built-in English statistics or dictionary
     -rr        Raw; do not remove nroff commands from the input
     -ss        Produce _d_i_g_r_a_m_s and _t_r_i_g_r_a_m_s files (maintenance only)
#umask
uummaasskk -- Set the file-creation mask

uummaasskk [_m_a_s_k]

The shell executes uummaasskk directly.
#umount
uummoouunntt -- Unmount file system

/eettcc/uummoouunntt _s_p_e_c_i_a_l

#unalias
uunnaalliiaass -- Remove an alias

uunnaalliiaass _a_l_i_a_s ...
kksshh only.  kksshh only.

#uncompress
uunnccoommpprreessss -- Uncompress a compressed file

uunnccoommpprreessss [ -ww _t_m_p_f_i_l_e ] [ _f_i_l_e ... ] (COHERENT 286)
uunnccoommpprreessss [ _f_i_l_e ... ] (COHERENT 386)

_O_p_t_i_o_n:
     -ww        Use _t_m_p_f_i_l_e as the workfile (default, /ddeevv/rraamm11) COHERENT 286
               only.
#uniq
uunniiqq -- Remove/count repeated lines in a sorted file

uunniiqq [-ccdduu] [-_n] [+_n] [_i_n_f_i_l_e[_o_u_t_f_i_l_e]]

_O_p_t_i_o_n_s:
     -cc        Print duplication count with lines
     -dd        Print only duplicated lines
     -nn        Skip _n fields during comparison
     +nn        Skip _n characters (after skipping fields)
     -uu        Print only non-repeated lines
#units
uunniittss -- Convert measurements

uunniittss [ -uu ]

_O_p_t_i_o_n:
     -uu        Update binary file only

uunniittss works interactively.
#unmkfs
uunnmmkkffss -- Construct a prototype file system

uunnmmkkffss [-_p_r_e_f_i_x] _d_i_r_e_c_t_o_r_y _n_b_l_o_c_k_s [_f_i_l_e]

#until
uunnttiill -- Execute commands repeatedly

uunnttiill _s_e_q_u_e_n_c_e_1 [ ddoo _s_e_q_u_e_n_c_e_2 ] ddoonnee

Both ddoo and ddoonnee must be the first token on a line or preceded by `;'.  The
shell executes uunnttiill directly.
#update
uuppddaattee -- Update file systems periodically

/eettcc/uuppddaattee

update -- Update file systems periodically Usage:       /etc/update
#ustar
uussttaarr -- Process tape archives

uussttaarr -cc[vvww] [-ff _a_r_c_h_i_v_e] _f_i_l_e ...
uussttaarr -rr[vvww] [-ff _a_r_c_h_i_v_e] _f_i_l_e ...
uussttaarr -tt[vv] [-ff _a_r_c_h_i_v_e]
uussttaarr -xx[llmmoovvww] [-ff _a_r_c_h_i_v_e] [_f_i_l_e ...]

_O_p_t_i_o_n_s:
     -cc        Create a new archive
     -rr        Append _f_i_l_e into _a_r_c_h_i_v_e
     -tt        Print table of contents for _a_r_c_h_i_v_e
     -xx        Extract _f_i_l_e from _a_r_c_h_i_v_e
_M_o_d_i_f_i_e_r_s:
     -ff        Next argument names output archive
     -ll        Print error message if all links cannot be resolved (cc or rr
               commands only)
     -mm        Do not restore modification time (invalid with tt)
     -oo        Give extracted files your user and group identifiers (xx command
               only)
     -vv        Verbose option
     -ww        Wait option: wait for confirmation before continuing
#uucheck
uuuucchheecckk -- Sanity-check the UUCP system

uuuucchheecckk [ -ffssvv ]

_O_p_t_i_o_n_s:
     -ff        Attempt to ``fix'' any problems found
     -ss        Run in ``silent'' mode, generating no output
     -vv        Run in ``verbose'' mode, generating extra output
#uucico
uuuucciiccoo -- Transmit data to or from a remote site

/uussrr/lliibb/uuuuccpp/uuuucciiccoo [ -cc_s_i_t_e ] [ -rr11 ] [ -ss_s_i_t_e ] [ -ssaallll ] [ -SS_s_i_t_e ] [ -xx_l_e_v_e_l ]

_O_p_t_i_o_n_s:
     -cc_s_i_t_e    Poll _s_i_t_e only if a file is queued for transmission to it
     -rr00       Act as slave in polling process
     -rr11       Act as master in polling process; default
     -ss_s_i_t_e    Name _s_i_t_e as a place to be polled
     -ssaallll     Poll all sites automatically
     -SS_s_i_t_e    Poll _s_i_t_e unconditionally
     -xx_l_e_v_e_l   Run in debug mode; _l_e_v_e_l sets level of debugging, from 1 to 10
#uucp
uuuuccpp -- Ready files for transmission to other systems

uuuuccpp [ -ccCCddffmmrr ] [-nn_u_s_e_r] [-ss _d_i_r] [-xx_n] _s_o_u_r_c_e ... _d_e_s_t

_O_p_t_i_o_n_s:
     -cc        Do not copy source to spool directory; rather use the file
               itself (default)
     -CC        Copy source file to spool directory
     -dd        Create directories as required on destination
     -ff        Do not make intermediate directories.
     -mm        Send mail to requester when file is sent
     -nn_u_s_e_r    Notify _u_s_e_r (on destination system) when file received
     -rr        Spool transfer request, do not initiate uuuucciiccoo
     -xx_l_e_v_e_l   Assign debug _l_e_v_e_l (0 to 9)
#uucpname
uuuuccppnnaammee -- Set the system's UUCP name

/eettcc/uuuuccppnnaammee

#uudecode
uuuuddeeccooddee -- Decode a binary file sent from a remote system

uuuuddeeccooddee [ _f_i_l_e ]

#uuencode
uuuueennccooddee -- Encode a binary file for transmission

uuuueennccooddee [ _s_o_u_r_c_e ] _r_e_m_o_t_e_d_e_s_t

#uuinstall
uuuuiinnssttaallll -- Install UUCP

uuuuiinnssttaallll

#uulog
uuuulloogg -- Examine UUCP operations

uuuulloogg [ -ffxx ] [ _s_y_s_t_e_m ]

_O_p_t_i_o_n_s:
     -ff        Show UUCP activity as it is logged; like ttaaiill -ff
     -xx        Display logs for uuuuxxqqtt instead of uuuucciiccoo
#uumvlog
uuuummvvlloogg -- Archive UUCP log files

uuuummvvlloogg _d_a_y_s

_O_p_t_i_o_n_s:
     _d_a_y_s      Number of days for which logs should be kept
#uuname
uuuunnaammee -- List UUCP names of known systems

uuuunnaammee [ -ll ]

_O_p_t_i_o_n:
     -ll        Print name of the local system
#uurmlock
uuuurrmmlloocckk -- Remove UUCP lock files

uuuurrmmlloocckk

#uutouch
uuuuttoouucchh -- Touch a file to trigger uucico poll

uuuuttoouucchh _s_y_s_t_e_m

#uux
uuuuxx -- Execute a command on a remote system

uuuuxx [-aa _u_s_e_r] [-rrnnppzz] _c_o_m_m_a_n_d-_s_t_r_i_n_g

_O_p_t_i_o_n_s:
     -aa _u_s_e_r   Name _u_s_e_r as requester
     -gg _l      Set importance of transmission; _l is a single ASCII character
     -nn        Suppress notification of command completion
     -pp        Input to uuuuxx is a pipe or input redirection
     -rr        Queue uuuuxx request; do not invoke uuuucciiccoo
     -zz        Notify requestor when _c_o_m_m_a_n_d-_l_i_n_e succeeds
#uuxqt
uuuuxxqqtt -- Execute commands requested by a remote system

uuuuxxqqtt

#vi
vvii -- Clone of Berkeley-style screen editor

vvii [ _o_p_t_i_o_n_s ] [ +_c_m_d ] [ _f_i_l_e_1 ... _f_i_l_e_2_7 ]

_O_p_t_i_o_n_s:
     -ee        Begin in colon-command mode
     -ii        Begin in input mode
     -rr        Recover a previous edit
     -RR        Read-only mode
     -tt _t_a_g    Begin editing at _t_a_g
     -mm        Use in error-handling mode
     -vv        Begin in visual-command mode
     +_c_o_m_m_a_n_d  Execute _c_o_m_m_a_n_d before editing
#view
vviieeww -- Screen-oriented viewing utility

vviieeww _f_i_l_e_1 ... _f_i_l_e_2_7

#virec
vviirreecc -- Recover the modified version of a file after a crash

vviirreecc [-dd _t_m_p_d_i_r] _t_e_x_t_f_i_l_e_n_a_m_e...
vviirreecc </ttmmpp/eellvv_X_X_X

#wait
wwaaiitt -- Await completion of background process

wwaaiitt [_p_i_d]

_p_i_d identifies the process whose completion is awaited.  If no _p_i_d is given,
wwaaiitt awaits completion of all background processes.  The shell executes wwaaiitt
directly.
#wall
wwaallll -- Send a message to all logged-in users

/eettcc/wwaallll

#wc
wwcc -- Count words, lines, and characters in text files

wwcc [-ccllww] [_f_i_l_e...]

_O_p_t_i_o_n_s:
     -cc        Print count of characters
     -ll        Print count of lines
     -ww        Print count of words

If no _f_i_l_e is given, wwcc reads stdin; if more than one _f_i_l_e is given, it also
prints a total.
#whence
wwhheennccee -- List a command's type

wwhheennccee [-vv] _c_o_m_m_a_n_d ...

kksshh only.
#whereis
wwhheerreeiiss -- Locate source, binary, and manual files

wwhheerreeiiss [-bbmmrrssuu] [-BBMMSS _d_i_r ... -ff] _n_a_m_e ...

_O_p_t_i_o_n_s:
     -bb        Search only for for binary files
     -mm        Search only for manual pages
     -rr        Search each _d_i_r downwardly recursively
     -ss        Search only for source files
     -uu        Search for unusual files
     -BB        Search each _d_i_r for binary files
     -MM        Search each _d_i_r for manual pages
     -RR        Search each _d_i_r downwardly recursively
     -SS        Search each _d_i_r for source files
     -ff        Terminate directory list begun by -BBMMRRSS options
#which
wwhhiicchh -- Locate executable files

wwhhiicchh _c_o_m_m_a_n_d ...

#while
wwhhiillee -- Execute commands repeatedly

wwhhiillee _s_e_q_u_e_n_c_e_1 [ddoo _s_e_q_u_e_n_c_e_2] ddoonnee

Both ddoo and ddoonnee must be the first token on a line or preceded by `;'.  The
shell executes wwhhiillee directly.
#who
wwhhoo -- Print who is logged in

wwhhoo [_f_i_l_e] [aamm ii]

#write
wwrriittee -- Converse with another user

wwrriittee _u_s_e_r [ _t_t_y ]

Name the _t_t_y if _u_s_e_r is logged in on more than one port.
#yacc
yyaacccc -- Parser generator

yyaacccc [_o_p_t_i_o_n ...] _f_i_l_e
cccc yy.ttaabb.cc [-llyy]

_O_p_t_i_o_n_s:
     -dd        Enable debugging output (implies -vv)
     -hhddrr      Next argument is name of header file (default, yy.ttaabb.hh)
     -iitteemmss    AAllllooww _N items per state.
     -ll        Next argument is name of listfile (default, yy.oouuttppuutt)
     sspprroodd _N   Allow _N symbols per production (default, 20)
     -sstt       Print statistics on standard output
     -vv        Verbose (extra output in listfile)

After each of the following, the next argument is a number to reset table size:
     -nntteerrmmss   Nonterminal symbols (default, 100)
     -pprrooddss    Productions or rules (default, 350)
     -ssttaatteess   States (default, 300)
     -tteerrmmss    Terminal symbols (default, 300)
     -ttyyppeess    Types (default, 10)
#yes
yyeess -- Print infinitely many responses

yyeess [ _s_t_r_i_n_g ]

#zcat
zzccaatt -- Concatenate a compressed file

zzccaatt [-ww _t_m_p_f_i_l_e ] [ _f_i_l_e ... ] (COHERENT 286)
zzccaatt [ _f_i_l_e ... ] (COHERENT 386)

     -ww _t_m_p_f_i_l_e
               Use _t_m_p_f_i_l_e as the workfile (default, /ddeevv/rraamm11).  COHERENT 286
               only.

unix.superglobalmegacorp.com

This archive runs on limited infrastructure. Preserving old code on modern bandwidth. Automated agents are requested to crawl responsibly.